DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and LIMD2

DIOPT Version :10

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_085053.1 Gene:LIMD2 / 80774 HGNCID:28142 Length:127 Species:Homo sapiens


Alignment Length:76 Identity:29/76 - (38%)
Similarity:36/76 - (47%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAP 142
            |.|..|:|.||.||.::..    ..|||.:|..||.|...|...||....|..||..||:.:|..
Human    38 ETCAACQKTVYPMERLVAD----KLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKS 98

  Fly   143 KVVYEEFTPRK 153
            |..|:|...||
Human    99 KGNYDEGFGRK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 20/55 (36%)
LIMD2NP_085053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
LIM_Eplin_like_1 40..92 CDD:188870 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.