DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and Limd2

DIOPT Version :9

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001343387.1 Gene:Limd2 / 67803 MGIID:1915053 Length:128 Species:Mus musculus


Alignment Length:76 Identity:29/76 - (38%)
Similarity:36/76 - (47%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAP 142
            |.|..|:|.||.||.::..    ..|||.:|..||.|...|...||....|..||..||:.:|..
Mouse    39 ETCAACQKTVYPMERLVAD----KLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKS 99

  Fly   143 KVVYEEFTPRK 153
            |..|:|...||
Mouse   100 KGNYDEGFGRK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 20/55 (36%)
Limd2NP_001343387.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
LIM_Eplin_like_1 41..93 CDD:188870 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6650
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.