DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and limd2

DIOPT Version :9

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:XP_009297834.1 Gene:limd2 / 560139 ZFINID:ZDB-GENE-120906-1 Length:131 Species:Danio rerio


Alignment Length:108 Identity:36/108 - (33%)
Similarity:47/108 - (43%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FDDLQKRNVIHVRSRDSKKAQSLFRSTIPEKVENCHQCKKPVYKMEEVILSLKTATTIFHKTCLR 110
            |:|  .||     :.|.|..|.....:...:.|.|..|:|.||.||.::.:    ..|||..|..
Zfish    17 FED--NRN-----TSDEKPVQRSKSFSFKTQKETCASCEKTVYPMERLVAN----NLIFHAACFC 70

  Fly   111 CKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAPKVVYEEFTPRK 153
            ||.|...|...||....|..||..||:.:|..|..|:|...||
Zfish    71 CKHCNTKLSLGSYAALQGEFYCKPHFQQLFKSKGNYDEGFGRK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 20/55 (36%)
limd2XP_009297834.1 LIM_Eplin_like_1 44..96 CDD:188870 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.