DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and Crip3

DIOPT Version :9

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001102773.1 Gene:Crip3 / 501100 RGDID:1565018 Length:204 Species:Rattus norvegicus


Alignment Length:78 Identity:28/78 - (35%)
Similarity:39/78 - (50%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FRSTIPEKVENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCS 133
            :..|...:...|..|..|||..|:| :||...   :|:.||||:.|.|.|...|:..|||..||.
  Rat   113 YLKTFTGETSLCPGCGDPVYFAEKV-MSLGRN---WHRPCLRCQRCRKTLTAGSHAEHDGMPYCH 173

  Fly   134 MH-FKLIFAPKVV 145
            :. :..:|.||.|
  Rat   174 IPCYGYLFGPKGV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 23/56 (41%)
Crip3NP_001102773.1 LIM1_TLP 5..58 CDD:188860
LIM 124..177 CDD:295319 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.