DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and Crip3

DIOPT Version :10

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001102773.1 Gene:Crip3 / 501100 RGDID:1565018 Length:204 Species:Rattus norvegicus


Alignment Length:78 Identity:28/78 - (35%)
Similarity:39/78 - (50%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FRSTIPEKVENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCS 133
            :..|...:...|..|..|||..|:| :||...   :|:.||||:.|.|.|...|:..|||..||.
  Rat   113 YLKTFTGETSLCPGCGDPVYFAEKV-MSLGRN---WHRPCLRCQRCRKTLTAGSHAEHDGMPYCH 173

  Fly   134 MH-FKLIFAPKVV 145
            :. :..:|.||.|
  Rat   174 IPCYGYLFGPKGV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 23/56 (41%)
Crip3NP_001102773.1 LIM1_TLP 5..58 CDD:188860
LIM 124..177 CDD:413332 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.