DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and crip2l

DIOPT Version :10

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001005968.1 Gene:crip2l / 449795 ZFINID:ZDB-GENE-041010-43 Length:202 Species:Danio rerio


Alignment Length:102 Identity:32/102 - (31%)
Similarity:47/102 - (46%) Gaps:20/102 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SRDSKKAQSLFRSTIPEKVENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSY 123
            :|...||.|.  |:...:...|.:|.|.||..|:|    .:....:|:.||||:.|.|.|...|:
Zfish   102 TRGPVKAASF--SSFSGEPNICPRCNKTVYFAEKV----SSLGKDWHRPCLRCERCSKTLAAGSH 160

  Fly   124 NVHDGSLYCSMH---FKLIFAPK---------VVYEE 148
            ..|||..||  |   :.::|.||         .:||:
Zfish   161 AEHDGQPYC--HKPCYAVLFGPKGVNTGGVGSYIYED 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 22/58 (38%)
crip2lNP_001005968.1 LIM1_TLP 5..58 CDD:188860
LIM1_TLP 121..174 CDD:188860 22/58 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.