DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and Mical2

DIOPT Version :9

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:XP_038941120.1 Gene:Mical2 / 365352 RGDID:1311773 Length:1103 Species:Rattus norvegicus


Alignment Length:122 Identity:35/122 - (28%)
Similarity:52/122 - (42%) Gaps:13/122 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SKKAQSLFRSTIPEKV---ENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSY 123
            |...:||.::..|..:   :.|:.|||.||.||.    |......||:.|.||..|...|:..:|
  Rat   960 SPDLESLRKAEFPLSLGGRDTCYFCKKRVYVMER----LSAEGHFFHRECFRCSVCAAILRVAAY 1020

  Fly   124 --NVHDGSLYCSMHFKLIFAPKVVYEEFTPRKAELIIRENQPIKLPPDVAKASDKPS 178
              :..:|..||.:|    ||......:...|:|||..:..:....|...|...|.|:
  Rat  1021 AFDCDEGKFYCKLH----FAHCKTSSKQRKRRAELNQQREEEGTWPEQEAARRDVPA 1073

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 20/57 (35%)
Mical2XP_038941120.1 FAD_binding_3 87..>274 CDD:396193
CH_MICAL2 514..623 CDD:409099
LIM_Mical 981..1035 CDD:188823 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.