DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33521 and CG30178

DIOPT Version :9

Sequence 1:	NP_001014703.1	Gene:	CG33521 / 3346141	FlyBaseID:	FBgn0250819	Length:	663	Species:	Drosophila melanogaster
Sequence 2:	NP_726395.1	Gene:	CG30178 / 246501	FlyBaseID:	FBgn0050178	Length:	187	Species:	Drosophila melanogaster

Alignment Length:	64	Identity:	18/64 - (28%)
Similarity:	31/64 - (48%)	Gaps:	5/64 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    80 CHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAPK 143
            |..|:.|:.:.     .:..|...:|:.|.||..|.|.|...|:...:|.|:|..||:.:|:.:
  Fly    65 CSACRTPILER-----GVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSR 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33521	NP_001014703.1	LIM_Mical_like_2	80..136	CDD:188829	15/55 (27%)
CG30178	NP_726395.1	LIM	6..61	CDD:295319
		LIM	65..116	CDD:259829	15/55 (27%)
		LIM	124..171	CDD:295319	18/64 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S6650
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.860