DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and valv-1

DIOPT Version :9

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_501187.1 Gene:valv-1 / 182010 WormBaseID:WBGene00015216 Length:84 Species:Caenorhabditis elegans


Alignment Length:67 Identity:26/67 - (38%)
Similarity:37/67 - (55%) Gaps:6/67 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NCHQCKKPVYKMEEVILSLKTATTIFHKTCLRC--KDCGKHLKFDSYNVHDGSLYCSMHFKLIFA 141
            ||..|:||||..|.|    .:....:|:.||:|  |.|||.|...|::.|:|..||:..:..:|.
 Worm     3 NCPNCQKPVYFAERV----SSLGKDWHRPCLKCANKACGKTLSAGSHSEHEGKPYCNRCYGALFG 63

  Fly   142 PK 143
            ||
 Worm    64 PK 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 22/57 (39%)
valv-1NP_501187.1 LIM_TLP_like 4..58 CDD:188785 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24215
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.