powered by:
Protein Alignment CG33521 and valv-1
DIOPT Version :9
Sequence 1: | NP_001014703.1 |
Gene: | CG33521 / 3346141 |
FlyBaseID: | FBgn0250819 |
Length: | 663 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_501187.1 |
Gene: | valv-1 / 182010 |
WormBaseID: | WBGene00015216 |
Length: | 84 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 26/67 - (38%) |
Similarity: | 37/67 - (55%) |
Gaps: | 6/67 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 NCHQCKKPVYKMEEVILSLKTATTIFHKTCLRC--KDCGKHLKFDSYNVHDGSLYCSMHFKLIFA 141
||..|:||||..|.| .:....:|:.||:| |.|||.|...|::.|:|..||:..:..:|.
Worm 3 NCPNCQKPVYFAERV----SSLGKDWHRPCLKCANKACGKTLSAGSHSEHEGKPYCNRCYGALFG 63
Fly 142 PK 143
||
Worm 64 PK 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR24215 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.