DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and CSRP2

DIOPT Version :10

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001400468.1 Gene:CSRP2 / 1466 HGNCID:2470 Length:243 Species:Homo sapiens


Alignment Length:66 Identity:23/66 - (34%)
Similarity:33/66 - (50%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAP 142
            |.|.:|...||..|::|.:.|.    :||.|.||..|||.|:..:....:|.:||...:...|.|
Human   167 EKCSRCGDSVYAAEKIIGAGKP----WHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGP 227

  Fly   143 K 143
            |
Human   228 K 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 19/55 (35%)
CSRP2NP_001400468.1 LIM1_CRP2 9..63 CDD:188864
LIM2_CRP2 169..222 CDD:188871 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.