powered by:
Protein Alignment CG33521 and CSRP2
DIOPT Version :9
Sequence 1: | NP_001014703.1 |
Gene: | CG33521 / 3346141 |
FlyBaseID: | FBgn0250819 |
Length: | 663 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001287894.1 |
Gene: | CSRP2 / 1466 |
HGNCID: | 2470 |
Length: | 193 |
Species: | Homo sapiens |
Alignment Length: | 66 |
Identity: | 23/66 - (34%) |
Similarity: | 33/66 - (50%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 ENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAP 142
|.|.:|...||..|::|.:.|. :||.|.||..|||.|:..:....:|.:||...:...|.|
Human 117 EKCSRCGDSVYAAEKIIGAGKP----WHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGP 177
Fly 143 K 143
|
Human 178 K 178
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.