DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and CSRP2

DIOPT Version :9

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001287894.1 Gene:CSRP2 / 1466 HGNCID:2470 Length:193 Species:Homo sapiens


Alignment Length:66 Identity:23/66 - (34%)
Similarity:33/66 - (50%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAP 142
            |.|.:|...||..|::|.:.|.    :||.|.||..|||.|:..:....:|.:||...:...|.|
Human   117 EKCSRCGDSVYAAEKIIGAGKP----WHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGP 177

  Fly   143 K 143
            |
Human   178 K 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 19/55 (35%)
CSRP2NP_001287894.1 LIM1_CRP2 9..63 CDD:188864
Nuclear localization signal. /evidence=ECO:0000255 64..69
LIM2_CRP2 119..172 CDD:188871 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.