DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and Csrp1

DIOPT Version :10

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_031817.1 Gene:Csrp1 / 13007 MGIID:88549 Length:193 Species:Mus musculus


Alignment Length:82 Identity:30/82 - (36%)
Similarity:42/82 - (51%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SKKAQSLFRSTIPEKVENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVH 126
            ||.||.:..|      |.|.:|.:.||..|:||.:.|:    :||:|.||..|||.|:..:....
Mouse   107 SKFAQKIGGS------ERCPRCSQAVYAAEKVIGAGKS----WHKSCFRCAKCGKGLESTTLADK 161

  Fly   127 DGSLYCSMHFKLIFAPK 143
            ||.:||...:...|.||
Mouse   162 DGEIYCKGCYAKNFGPK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 21/55 (38%)
Csrp1NP_031817.1 LIM1_CRP1 8..63 CDD:188863
Nuclear localization signal. /evidence=ECO:0000255 64..69
LIM2_CRP 119..172 CDD:188787 21/56 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.