DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and Csrp3

DIOPT Version :9

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_476485.2 Gene:Csrp3 / 117505 RGDID:71092 Length:194 Species:Rattus norvegicus


Alignment Length:225 Identity:49/225 - (21%)
Similarity:79/225 - (35%) Gaps:62/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAPKV 144
            |..|.|.||..||:..:.::    |||||..|..|.|.|...:...|:..:||.:.:...:.||.
  Rat    10 CGACDKTVYHAEEIQCNGRS----FHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRKYGPKG 70

  Fly   145 V--------------------YEEFTPRKAELIIRENQPIKLPPDVAKASDKPSLGLDELQELNL 189
            :                    ::: :|:.|......| |.|......::...|..|      .::
  Rat    71 IGFGQGAGCLSTDTGEHLGLQFQQ-SPKPARAATTSN-PSKFSAKFGESEKCPRCG------KSV 127

  Fly   190 RSKFKVFENGYEEHNNNLRERQDIAITHSKSIQSTLTKFHGLGIPNSELTKLDDKNSDNNSDGDG 254
            .:..||...|...|....|    .||. .||::||                       |.:|.||
  Rat   128 YAAEKVMGGGKPWHKTCFR----CAIC-GKSLEST-----------------------NVTDKDG 164

  Fly   255 DMNF-MCLKKEIERETPVGLGEAMNDIRSK 283
            ::.. :|..|.. ..|.:|.|...:.:..|
  Rat   165 ELYCKVCYAKNF-GPTGIGFGGLTHQVEKK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 19/55 (35%)
Csrp3NP_476485.2 Interaction with TCAP. /evidence=ECO:0000250|UniProtKB:P50461 1..5
LIM1_CRP3 9..62 CDD:188865 19/55 (35%)
Nuclear localization signal. /evidence=ECO:0000255, ECO:0000305|PubMed:19376126 64..69 0/4 (0%)
Interaction with CLF2. /evidence=ECO:0000250|UniProtKB:P50461 94..105 2/11 (18%)
LIM2_CRP3 120..173 CDD:188866 18/86 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.