DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cwc25 and CWC25

DIOPT Version :9

Sequence 1:NP_608705.1 Gene:Cwc25 / 33460 FlyBaseID:FBgn0031452 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_014154.1 Gene:CWC25 / 855476 SGDID:S000005189 Length:179 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:59/180 - (32%)
Similarity:88/180 - (48%) Gaps:12/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGGDLNLKKSWHPHTMKNQERVWKAEEQAKMEERKLQDLRKEINEERDREELRRLGESS----G 61
            ||.|||||.|||:|..|||:::||:.|:....|::||....|||.:||:..||  |.|||    .
Yeast     1 MGSGDLNLLKSWNPKLMKNRKKVWETEQDLITEQQKLNTRLKEIEKERELNEL--LNESSKDKPE 63

  Fly    62 VLSNNGGAAGEAKLEWMYKNSTELINREEYLLG-RKIDKSFETLQAEESRQEQNTVGLKQTINHV 125
            .|.|: .|..::.|||||:::.....:|:|||| :|:|.|.....|....:...|:........:
Yeast    64 TLKND-LALKKSGLEWMYQDAKLSDEKEDYLLGKKKLDSSILNQPATPPVRAATTISASGAATSI 127

  Fly   126 EHDCVPFSIRTYRNVQSNEQVDIQRKTLEDPLMLIKQREMESRRKLLENP 175
            ........:.....:...:....||:|.:.    .|:|.|..|.|.|..|
Yeast   128 SSQKKKSKLLKDDPMSKFKVTKQQRRTPDS----TKKRAMSQRGKPLSKP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cwc25NP_608705.1 Cir_N 11..44 CDD:287204 13/32 (41%)
CWC25 72..174 CDD:289319 24/102 (24%)
CWC25NP_014154.1 Cir_N 11..47 CDD:198151 15/35 (43%)
CWC25 74..153 CDD:403663 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003473
OrthoInspector 1 1.000 - - oto99410
orthoMCL 1 0.900 - - OOG6_103842
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R270
SonicParanoid 1 1.000 - - X3363
TreeFam 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.