DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cwc25 and AT2G44195

DIOPT Version :9

Sequence 1:NP_608705.1 Gene:Cwc25 / 33460 FlyBaseID:FBgn0031452 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_181948.2 Gene:AT2G44195 / 819027 AraportID:AT2G44195 Length:155 Species:Arabidopsis thaliana


Alignment Length:158 Identity:40/158 - (25%)
Similarity:69/158 - (43%) Gaps:36/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKSWHPHTMKNQERVWKAEEQAKMEERKLQDLRKEINEERDREELRRLGESSGVLSNNGGAAGEA 73
            ||.||..:::|.|:|||||::.:.|:.|::          :|.|.|.:.|.:|::...     ..
plant     8 KKGWHTGSIRNVEKVWKAEQKHEAEQEKIE----------ERSEFRAIQEQAGLVPRR-----PE 57

  Fly    74 KLEWMYKNSTELINREEYLLGRKIDKSFETLQAEESRQEQNTVGLKQTINHVEHDCVPFSIRTYR 138
            :||::|  ..||...::.:...:....|   |.::.|......|.....:...|           
plant    58 RLEFLY--DPELAVAKQNVSSSRHGVLF---QNQDQRARATIPGALFDDDDKRH----------- 106

  Fly   139 NVQSNEQVDIQRKTLEDPLMLIKQREME 166
              .:|   |..||...|||:||:|:|.|
plant   107 --SAN---DSWRKFHSDPLLLIRQKEQE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cwc25NP_608705.1 Cir_N 11..44 CDD:287204 11/32 (34%)
CWC25 72..174 CDD:289319 22/95 (23%)
AT2G44195NP_181948.2 Cir_N 11..44 CDD:402000 13/42 (31%)
CWC25 57..129 CDD:403663 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1635950at2759
OrthoFinder 1 1.000 - - FOG0003473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.