DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9961 and LOC1275659

DIOPT Version :10

Sequence 1:NP_608704.2 Gene:CG9961 / 33459 FlyBaseID:FBgn0031451 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_061517707.1 Gene:LOC1275659 / 1275659 VectorBaseID:AGAMI1_006301 Length:484 Species:Anopheles gambiae


Alignment Length:38 Identity:8/38 - (21%)
Similarity:17/38 - (44%) Gaps:5/38 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 ISNNDLIESNLNRA----NNWCARERIKHYTVNAMERA 194
            :|..::..|.:.|.    |..|.:: :..|.:...|:|
Mosquito    39 LSEKEIRPSRVRRVPEQKNKLCGKQ-VLSYVMALCEKA 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9961NP_608704.2 Phosphoglycerate_kinase 36..447 CDD:444741 8/38 (21%)
LOC1275659XP_061517707.1 None

Return to query results.
Submit another query.