DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrs and AT5G16880

DIOPT Version :9

Sequence 1:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001331679.1 Gene:AT5G16880 / 831551 AraportID:AT5G16880 Length:407 Species:Arabidopsis thaliana


Alignment Length:330 Identity:83/330 - (25%)
Similarity:124/330 - (37%) Gaps:53/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DKNLENATSHLRLEPDWPSILLICDEINQKDVTPKNAFAAIKKKMNSPNPHSSCYSLLVLESIVK 71
            ||.:|:||:....||||...|.|||.|||:.:........|||::....|.....:|::||:.||
plant    49 DKIVEDATTENLEEPDWDMNLEICDMINQETINSVELIRGIKKRIMMKQPRIQYLALVLLETCVK 113

  Fly    72 NCGAPVHEEVFTKENCEMFSSFLESTPHENVRQKMLELVQTWAYAFRSSDKYQAIKDTMTILKAK 136
            ||.....|....:...||.....:.....|.|.|.|.|::.|..:..........::|...|||:
plant   114 NCEKAFSEVAAERVLDEMVKLIDDPQTVVNNRNKALMLIEAWGESTSELRYLPVFEETYKSLKAR 178

  Fly   137 GHTFPELREADAMFTADTAPNWADGRVCHRCRVEFTFTNRKH---HCRNCGQV--FCGQCTAKQC 196
            |..||. |:.:::     ||.:...|......:........|   |.:....|  |..:.|.:..
plant   179 GIRFPG-RDNESL-----APIFTPARSTPAPELNADLPQHVHEPAHIQYDVPVRSFTAEQTKEAF 237

  Fly   197 PLPKYGIEKEVRVCDGCFAALQRPTSGSGGAKSGPRPADSELPAEYLNSTLAQQV---QTPARKT 258
            .:.:..||           .|....|.|        |....|..: |.:||.||.   ||..::.
plant   238 DIARNSIE-----------LLSTVLSSS--------PQHDALQDD-LTTTLVQQCRQSQTTVQRI 282

  Fly   259 EQELKEEEEL---------QLALALSQSEAEQQKPK--LQSLPPAAYRMQQRSPSPEAPPEPKEY 312
            .:...|.|.|         :|...||:.| |..||.  |.|..||...:.:.       |:....
plant   283 IETAGENEALLFEALNVNDELVKTLSKYE-EMNKPSAPLTSHEPAMIPVAEE-------PDDSPI 339

  Fly   313 HQQPE 317
            |.:.|
plant   340 HGREE 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HrsNP_525099.3 VHS_Hrs_Vps27p 2..143 CDD:239626 43/135 (32%)
FYVE_Hrs 157..217 CDD:277260 8/64 (13%)
Hrs_helical 377..471 CDD:289018
GBP_C <456..520 CDD:303769
coiled coil 501..512 CDD:293879
AT5G16880NP_001331679.1 VHS 49..177 CDD:340765 38/127 (30%)
GAT_GGA-like_plant 237..313 CDD:410579 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.