DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrs and Zfyve19

DIOPT Version :9

Sequence 1:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_038961609.1 Gene:Zfyve19 / 499871 RGDID:1561576 Length:393 Species:Rattus norvegicus


Alignment Length:405 Identity:86/405 - (21%)
Similarity:144/405 - (35%) Gaps:108/405 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQRPTSGSGGAK 228
            |:.|.|:||...:::.|:|||:.||..|.:....:|:.| ..:.:||..|...|.|.:|.:....
  Rat     5 CYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAG-NTQQKVCKQCHTVLTRGSSDTASKW 68

  Fly   229 SGPRPADSELPA-EYLNSTLAQQVQTPARKTE----------QELK-----EEEELQLALALSQS 277
            |.|:.....:.| |....:.|.|.|....|.:          ||.|     .:.|::..||..:.
  Rat    69 SPPQNYKKRVAALEAKKKSSASQSQGLTHKDQAIAERLARLRQENKPKSIPSQAEIEARLAALKD 133

  Fly   278 EAEQQKPKLQSLPPAAYRMQQRSPSPEAPPEPKEYHQQPEEATNPELAKYLNRSYWEQRKISESS 342
            |.:...|..|.:......:|.|:|.|..   .:..||.|:..|                      
  Rat   134 EVQGPIPSTQEMEDRLAALQGRAPPPHT---MRPVHQAPDTRT---------------------- 173

  Fly   343 SMASPSAPSPMPPTPQPQQIMPLQVKSADEVQIDEFAANMRTQVEIFVNRMKSNSSRGRSISNDS 407
                           |.||...|..:...||.|||   |.:.:|.....:...|....|:...||
  Rat   174 ---------------QAQQTQDLLTQLTAEVAIDE---NWQPRVSAAPPQNSLNKGGTRNQHTDS 220

  Fly   408 SVQTLFMTLTSLHSQQLSYIKEMDDKRMWYEQLQDKLTQIKDSRAALDQLRQEHVEKLRRIAEEQ 472
            ..|      .||                  |:.::||            |.:..||    :.||.
  Rat   221 QGQ------ASL------------------EEEKNKL------------LAEASVE----LQEEN 245

  Fly   473 ERQ-RQMQMAQKLDIMRKKKQEYLQYQRQLALQRIQEQEREMQLRQE-QQKAQYLMGQSAPPFPY 535
            .|| |.:.:|::|.:::.:....:..|........::::.|..:|:. ||..:......|..|  
  Rat   246 TRQERILALARRLAVLKGQDPSRVTLQDYHLPDSDEDEDEETAIRRVLQQLTEEAALDEASGF-- 308

  Fly   536 MPPSAVPQHGSPSHQ 550
                .:|:..:|:.|
  Rat   309 ----NIPEEPAPASQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HrsNP_525099.3 VHS_Hrs_Vps27p 2..143 CDD:239626
FYVE_Hrs 157..217 CDD:277260 17/52 (33%)
Hrs_helical 377..471 CDD:289018 16/93 (17%)
GBP_C <456..520 CDD:303769 13/65 (20%)
coiled coil 501..512 CDD:293879 0/10 (0%)
Zfyve19XP_038961609.1 FYVE_ZFY19 4..54 CDD:277288 16/49 (33%)
Bbox1_ANCHR-like 340..384 CDD:380875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.