DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrs and Wdfy2

DIOPT Version :9

Sequence 1:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster


Alignment Length:95 Identity:33/95 - (34%)
Similarity:43/95 - (45%) Gaps:18/95 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EADAMFTADTAPNWADGRVCHRCRVEFTFTN------------RKHHCRNCGQVFCGQCTAKQCP 197
            |.:||  ....|.|.|...|..|...| |.|            |:||||:||:..|..|:..:..
  Fly   278 EMNAM--RKEVPGWVDTNNCQLCSRPF-FWNFRSMMDQKQLGIRQHHCRHCGKAVCDNCSTNRIN 339

  Fly   198 LPKYGIEKEVRVCDGCFAALQ---RPTSGS 224
            :|..|.|.:||.||.|:..||   ||:..|
  Fly   340 IPIMGFEFDVRTCDPCYKQLQTVERPSLAS 369

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HrsNP_525099.3 VHS_Hrs_Vps27p 2..143 CDD:239626
FYVE_Hrs 157..217 CDD:277260 24/71 (34%)
Hrs_helical 377..471 CDD:289018
GBP_C <456..520 CDD:303769
coiled coil 501..512 CDD:293879
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 33/95 (35%)