DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrs and CG41099

DIOPT Version :9

Sequence 1:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster


Alignment Length:176 Identity:56/176 - (31%)
Similarity:72/176 - (40%) Gaps:41/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PVHEEVFTKEN------CEMFSSFLESTPHENVR-----------------QKMLELVQTWAYAF 117
            |:||.....|:      ||:   ||||.|...:.                 |..|..:...|.|.
  Fly   961 PLHELCRVVEDSTAGLICEL---FLESMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGAC 1022

  Fly   118 RSSDKYQAIKDTMTILKAKGHTFPELREADAMFTADTAPN---WADGRVCHRCRVEFTFTNRKHH 179
            ..::.    ||.:.|...|..|...|..     ..|..|.   ||:...|..|...||.|.||||
  Fly  1023 LGTEN----KDGINIFNFKLATDQLLHN-----LLDQLPQESPWAESDYCQHCTNRFTITMRKHH 1078

  Fly   180 CRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQRPTSGSG 225
            ||:||:|.|.:|:....|:.|:||.|.||||..||..||   .|:|
  Fly  1079 CRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQ---CGNG 1121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HrsNP_525099.3 VHS_Hrs_Vps27p 2..143 CDD:239626 20/89 (22%)
FYVE_Hrs 157..217 CDD:277260 29/62 (47%)
Hrs_helical 377..471 CDD:289018
GBP_C <456..520 CDD:303769
coiled coil 501..512 CDD:293879
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
Ank_2 579..670 CDD:289560
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:289560
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738 4/15 (27%)
ANK repeat 754..786 CDD:293786
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125 13/58 (22%)
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786 3/24 (13%)
FYVE_ANFY1 1054..1116 CDD:277267 29/61 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I3266
eggNOG 1 0.900 - - E1_KOG1818
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.