DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrs and CG15602

DIOPT Version :9

Sequence 1:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001285298.1 Gene:CG15602 / 32533 FlyBaseID:FBgn0030694 Length:342 Species:Drosophila melanogaster


Alignment Length:333 Identity:60/333 - (18%)
Similarity:110/333 - (33%) Gaps:130/333 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 CHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQRPTSGSGGAK 228
            |..|..::....:::.|.|||..||.:|..:..|:|::. .|...||..|:..|.:..:.     
  Fly     3 CFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVPRHA-GKVHNVCLICYDKLSKLQAS----- 61

  Fly   229 SGPRPADSE--LPAEYLNSTLAQQVQ--TPARKTE------QELKEEEELQLALALSQSEAEQQK 283
                 ||:|  :..:.|...|..::.  .|::.::      .:....|||..||.          
  Fly    62 -----ADAEKVIDCDALPGILVTKMNLAPPSKSSDGADALFNDSLPVEELPQALV---------- 111

  Fly   284 PKLQSLPPAAYRMQQRSPSPEAPPEPKEYHQQPEEATNPELAKYLNRSYWEQRKISESSSMASPS 348
                             ||..:.|..|::....:|..:.||.|                      
  Fly   112 -----------------PSSSSSPHSKDHKDHIDENLDSELTK---------------------- 137

  Fly   349 APSPMPPTPQPQQIMPLQVKSADEVQIDEFAANMRTQVEIFVNRMKSNSSRGRSISNDSSVQTLF 413
                               :..|..::|                           :.|..::|..
  Fly   138 -------------------RMQDYKRVD---------------------------ATDDEIRTRL 156

  Fly   414 MTLTSL-HSQQLSYIKE----MDDKRMWYEQLQDKLTQIKDSRAALDQLRQEHVEKLR--RIAEE 471
            ..||.: |::  ||.|:    ..|:|...|:::|.|.|..| .|.|||    ::.:.|  .|::.
  Fly   157 ANLTGMPHTK--SYDKKDLLLSTDQRNDQEKMRDLLAQFVD-EAQLDQ----NISRQRDDSISDI 214

  Fly   472 QERQRQMQ 479
            :.|.|.::
  Fly   215 ERRLRALR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HrsNP_525099.3 VHS_Hrs_Vps27p 2..143 CDD:239626
FYVE_Hrs 157..217 CDD:277260 15/52 (29%)
Hrs_helical 377..471 CDD:289018 21/100 (21%)
GBP_C <456..520 CDD:303769 5/26 (19%)
coiled coil 501..512 CDD:293879
CG15602NP_001285298.1 PHD_SF 2..52 CDD:304600 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.