| Sequence 1: | NP_525099.3 | Gene: | Hrs / 33458 | FlyBaseID: | FBgn0031450 | Length: | 760 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038967951.1 | Gene: | Zfyve1 / 299188 | RGDID: | 1307795 | Length: | 788 | Species: | Rattus norvegicus |
| Alignment Length: | 302 | Identity: | 64/302 - (21%) |
|---|---|---|---|
| Similarity: | 101/302 - (33%) | Gaps: | 107/302 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 RSSFDKNLENATSHLRLEPDWPSILLICDEINQKDVTPKNAFAAIKKKMNSPNP-----HSSCY- 61
Fly 62 -SLLVLESIVKNCGAPV------------HE-------------EVFTKENC------------- 87
Fly 88 -------------EMFSSFLESTPHENV----RQKML------------ELVQTW----AYAFRS 119
Fly 120 SDKYQAIKDTMTILKAKGHTFPEL-----READAMFTADTAP-NWADGR---VCHRCRVEFTFTN 175
Fly 176 RKHHCRNCGQVFCGQCTAKQCPLPKYGI-EKEVRVCDGCFAA 216 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Hrs | NP_525099.3 | VHS_Hrs_Vps27p | 2..143 | CDD:239626 | 34/217 (16%) |
| FYVE_Hrs | 157..217 | CDD:277260 | 25/64 (39%) | ||
| Hrs_helical | 377..471 | CDD:289018 | |||
| GBP_C | <456..520 | CDD:303769 | |||
| coiled coil | 501..512 | CDD:293879 | |||
| Zfyve1 | XP_038967951.1 | Bbox1_ZFYVE1_rpt1 | 16..63 | CDD:380877 | |
| Bbox1_ZFYVE1_rpt2 | 69..122 | CDD:380878 | |||
| GBP | 174..410 | CDD:206650 | 9/50 (18%) | ||
| FYVE_like_SF | 594..655 | CDD:333710 | 23/60 (38%) | ||
| FYVE_ZFYV1 | 722..782 | CDD:277273 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1818 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||