DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrs and zfyve1

DIOPT Version :9

Sequence 1:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_001344703.1 Gene:zfyve1 / 100005732 ZFINID:ZDB-GENE-131205-1 Length:779 Species:Danio rerio


Alignment Length:206 Identity:53/206 - (25%)
Similarity:79/206 - (38%) Gaps:73/206 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FTKENCEMFSSFLESTPHENVRQKMLELVQTWAYAFRSSDKYQAIKDTMTILKAKGHTFPELREA 146
            |.|:|             .|..|::|:.|...|         |::.: :::..||..|       
Zfish   550 FLKDN-------------NNAAQRLLDGVNFMA---------QSVSE-LSVKPAKAVT------- 584

  Fly   147 DAMFTADTAP-NWADGRV---CHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPK--YGIEK 205
             |..|...|| .|....:   |::|...|...:.|||||.||:.||..|::|..|:|:  :|: .
Zfish   585 -AWLTDQIAPAYWKPNSLILRCYKCGAGFEDNDTKHHCRACGEGFCDGCSSKTRPVPERGWGL-A 647

  Fly   206 EVRVCDGCFAALQRPTSGSGGAKSGPRPADSELPAEYLNSTLAQQVQTPARKTEQELKEEEELQL 270
            .|||||.||                   .:..:|.|.|::.|                ||||...
Zfish   648 PVRVCDACF-------------------QNRGIPEELLDAAL----------------EEEEGGT 677

  Fly   271 ALALSQSEAEQ 281
            .:|....||.|
Zfish   678 LIARKVGEAVQ 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HrsNP_525099.3 VHS_Hrs_Vps27p 2..143 CDD:239626 12/60 (20%)
FYVE_Hrs 157..217 CDD:277260 25/64 (39%)
Hrs_helical 377..471 CDD:289018
GBP_C <456..520 CDD:303769
coiled coil 501..512 CDD:293879
zfyve1XP_001344703.1 GBP 175..411 CDD:206650
PHD_SF 595..656 CDD:304600 23/61 (38%)
FYVE_ZFYV1 713..773 CDD:277273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.