Sequence 1: | NP_525099.3 | Gene: | Hrs / 33458 | FlyBaseID: | FBgn0031450 | Length: | 760 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001344703.1 | Gene: | zfyve1 / 100005732 | ZFINID: | ZDB-GENE-131205-1 | Length: | 779 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 79/206 - (38%) | Gaps: | 73/206 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 FTKENCEMFSSFLESTPHENVRQKMLELVQTWAYAFRSSDKYQAIKDTMTILKAKGHTFPELREA 146
Fly 147 DAMFTADTAP-NWADGRV---CHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPK--YGIEK 205
Fly 206 EVRVCDGCFAALQRPTSGSGGAKSGPRPADSELPAEYLNSTLAQQVQTPARKTEQELKEEEELQL 270
Fly 271 ALALSQSEAEQ 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrs | NP_525099.3 | VHS_Hrs_Vps27p | 2..143 | CDD:239626 | 12/60 (20%) |
FYVE_Hrs | 157..217 | CDD:277260 | 25/64 (39%) | ||
Hrs_helical | 377..471 | CDD:289018 | |||
GBP_C | <456..520 | CDD:303769 | |||
coiled coil | 501..512 | CDD:293879 | |||
zfyve1 | XP_001344703.1 | GBP | 175..411 | CDD:206650 | |
PHD_SF | 595..656 | CDD:304600 | 23/61 (38%) | ||
FYVE_ZFYV1 | 713..773 | CDD:277273 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1818 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |