DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment map4k5 and Pak

DIOPT Version :9

Sequence 1:XP_021336201.1 Gene:map4k5 / 334565 ZFINID:ZDB-GENE-030131-6497 Length:894 Species:Danio rerio
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:273 Identity:112/273 - (41%)
Similarity:164/273 - (60%) Gaps:9/273 - (3%)


- Green bases have known domain annotations that are detailed below.


Zfish    15 NPQHDFELIQRVGSGTYGDVYKARKISTGELAAVKIIKLEPGDDFSIIQQEIFMVKECTHHNIVA 79
            :|...:..::::|.|..|.||.|.:.|||...|:|.:.|.......:|..||.:::|..|.|:|.
  Fly   561 DPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVN 625

Zfish    80 YFGSYLCREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLGYLHSKGKMHRDIKGA 144
            |..|||..|:||:.|||..||||.|:...| .:.|.|||.||||.||.|.:||:...:|||||..
  Fly   626 YLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSD 689

Zfish   145 NILLTDNGDVKLADFGVAAKITATMAKRKSFIGTPYWMAPEVAAVEKNGGYNHLCDIWAVGITSI 209
            ||||..:|.|||.|||..|:|:...:||.:.:||||||||||...::   |....|:|::||.:|
  Fly   690 NILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQ---YGPKVDLWSLGIMAI 751

Zfish   210 ELAELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSTAFHNFVKLSLTKNPKRRPTAEKMLSH 274
            |:.|.:||..:.:|::||:|::.:.  .|::|:|.|.|:||.:|:...|.....||.:|..:|.|
  Fly   752 EMVEGEPPYLNENPLKALYLIATNG--KPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKH 814

Zfish   275 LFVGQTGLTRRLA 287
            .|:   .|.|.||
  Fly   815 PFL---KLARPLA 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
map4k5XP_021336201.1 STKc_MAP4K5 10..277 CDD:270813 107/261 (41%)
CNH 559..874 CDD:214481
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 108/265 (41%)
S_TKc 566..817 CDD:214567 106/256 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.