DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc1 and TPR14

DIOPT Version :10

Sequence 1:NP_995615.2 Gene:Tmtc1 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_201320.1 Gene:TPR14 / 836639 AraportID:AT5G65160 Length:593 Species:Arabidopsis thaliana


Alignment Length:328 Identity:66/328 - (20%)
Similarity:105/328 - (32%) Gaps:118/328 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 RNLDWRDEEQLFRSAISINPPKAL--GNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAH----- 555
            :|.::.:...|:.:||:|:|.||.  .|..:.|:|.||..:|....|..:...|....||     
plant   248 KNGNFAEALALYDAAIAIDPNKAAYRSNKSAALTALGRILDAVFECREAIRIEPHYHRAHHRLGN 312

  Fly   556 --FNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGD----------------- 601
              ..||.|.:...:|..:.|...|....:.:....:||..|....|.|                 
plant   313 LYLRLGEVEKSIYHFKHSGPEADREDIAKAKTVQTHLNKCTEAKRLRDWNGLITETTNTISSGAD 377

  Fly   602 ----------------HR---------------------------------------------QE 605
                            ||                                             .|
plant   378 AAPQVYALQAEALLKTHRHQEADDALSRCPVFDIDASTRYYGPVGYAGFLVVRAQVHLASGRFDE 442

  Fly   606 AISVLRTGARLEGSG------VRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRESLKALP- 663
            |:..::...:|:|:.      .|...|..|||:    :.:.|::| ||.|:|.||..|.|...| 
plant   443 AVEAIQRAGKLDGNNREVIMISRRAQAVTEARF----KGNELFKS-GRFQEACAAYGEGLDHDPR 502

  Fly   664 ---LLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYGQTLARNGSRLAEA 725
               ||  ..||....:||:....::|..       .|:.::|       .||:...|.....|:.
plant   503 NSVLL--CNRAACRSKLGQFDKSIEDCT-------AALSVRP-------GYGKARLRRADCNAKI 551

  Fly   726 ESW 728
            |.|
plant   552 EKW 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc1NP_995615.2 ArnT 11..>209 CDD:441412
TMTC_DUF1736 271..340 CDD:462468
PilF 501..585 CDD:442297 23/92 (25%)
TPR repeat 518..546 CDD:276809 9/29 (31%)
TPR repeat 551..581 CDD:276809 8/36 (22%)
LapB 556..838 CDD:442196 48/261 (18%)
TPR repeat 586..611 CDD:276809 9/102 (9%)
TPR repeat 634..660 CDD:276809 9/25 (36%)
TPR repeat 671..699 CDD:276809 5/27 (19%)
TPR repeat 704..735 CDD:276809 6/25 (24%)
TPR repeat 740..768 CDD:276809
TPR repeat 773..803 CDD:276809
TPR repeat 808..836 CDD:276809
TPR14NP_201320.1 TPR 235..>328 CDD:440225 21/79 (27%)
TPR repeat 236..264 CDD:276809 3/15 (20%)
TPR repeat 269..299 CDD:276809 9/29 (31%)
NrfG 288..466 CDD:443378 22/177 (12%)
TPR repeat 304..329 CDD:276809 6/24 (25%)
TPR 423..>585 CDD:440225 35/153 (23%)
TPR repeat 503..533 CDD:276809 8/38 (21%)
TPR repeat 538..562 CDD:276809 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.