DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and ODAD4

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_113609.1 Gene:ODAD4 / 83538 HGNCID:25280 Length:672 Species:Homo sapiens


Alignment Length:327 Identity:58/327 - (17%)
Similarity:103/327 - (31%) Gaps:121/327 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 KALGNLGSVLSAQGRYEE-----------AELTLRMT-LGHR----------------------- 548
            :||.|:|.|.:..|::::           |:.||..| |.|.                       
Human   361 RALDNIGRVFARVGKFQQAIDTWEEKIPLAKTTLEKTWLFHEIGRCYLELDQAWQAQNYGEKSQQ 425

  Fly   549 --PTMADAHFNLG---VVHQKQL---NFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQE 605
              ....|..:.|.   :|.|.|:   :|.||:..|.:|:|            ...|:...:.:|.
Human   426 CAEEEGDIEWQLNASVLVAQAQVKLRDFESAVNNFEKALE------------RAKLVHNNEAQQA 478

  Fly   606 AISVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGR---LQDAAAALRESLKALPLLPQ 667
            .||.|...         ::|...|.|.|.|:: ::..:|:|.   .:|......:.::.:...|:
Human   479 IISALDDA---------NKGIIRELRKTNYVE-NLKEKSEGEASLYEDRIITREKDMRRVRDEPE 533

  Fly   668 KQRAVLHLRLGEILAELQDWNEAEHQQRL---------AMQLQPEQGAAYVTYGQTLA------- 716
            |              .::.|:.:|.::..         |:| .|..|...|..|:..:       
Human   534 K--------------VVKQWDHSEDEKETDEDDEAFGEALQ-SPASGKQSVEAGKARSDLGAVAK 583

  Fly   717 -----------RNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQ-----------ERHHEA 759
                       ..|.:|.||.....|.:...|..........:|..|:           .|..|.
Human   584 GLSGELGTRSGETGRKLLEAGRRESREIYRRPSGELEQRLSGEFSRQEPEELKKLSEVGRREPEE 648

  Fly   760 LG 761
            ||
Human   649 LG 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 23/106 (22%)
TPR repeat 518..546 CDD:276809 10/38 (26%)
TPR repeat 551..581 CDD:276809 10/35 (29%)
TPR_1 552..584 CDD:278916 11/37 (30%)
TPR 565..841 CDD:223533 42/241 (17%)
TPR repeat 586..611 CDD:276809 4/24 (17%)
TPR repeat 634..660 CDD:276809 4/28 (14%)
TPR repeat 671..699 CDD:276809 3/36 (8%)
TPR repeat 704..735 CDD:276809 8/48 (17%)
TPR repeat 740..768 CDD:276809 6/33 (18%)
TPR repeat 773..803 CDD:276809
TPR 808..841 CDD:197478
TPR repeat 808..836 CDD:276809
ODAD4NP_113609.1 TPR 1. /evidence=ECO:0000255 13..46
TPR_11 16..78 CDD:290150
TPR repeat 16..41 CDD:276809
TPR repeat 46..76 CDD:276809
TPR 2. /evidence=ECO:0000255 48..80
TPR_11 49..112 CDD:290150
TPR 3. /evidence=ECO:0000255 81..114
TPR repeat 81..109 CDD:276809
TPR 4. /evidence=ECO:0000255 275..311
TPR repeat 311..349 CDD:276809
TPR_12 316..385 CDD:290160 6/23 (26%)
TPR 5. /evidence=ECO:0000255 320..353
TPR 6. /evidence=ECO:0000255 360..393 7/31 (23%)
TPR repeat 360..385 CDD:276809 6/23 (26%)
TPR_12 361..429 CDD:290160 12/67 (18%)
TPR 7. /evidence=ECO:0000255 397..430 3/32 (9%)
TPR_12 398..468 CDD:290160 13/81 (16%)
TPR repeat 431..465 CDD:276809 10/33 (30%)
TPR 8. /evidence=ECO:0000255 437..470 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 527..672 22/139 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.