DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31690 and Ttc32

DIOPT Version :9

Sequence 1:	NP_995615.2	Gene:	CG31690 / 33455	FlyBaseID:	FBgn0051690	Length:	859	Species:	Drosophila melanogaster
Sequence 2:	XP_003750178.1	Gene:	Ttc32 / 684830	RGDID:	1585566	Length:	148	Species:	Rattus norvegicus

Alignment Length:	99	Identity:	28/99 - (28%)
Similarity:	41/99 - (41%)	Gaps:	11/99 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   518 PKALGNLGSVLSAQGRYEEAELTLRMTLG----HR-----PTMADAHFNLGVVHQKQLNFSSAIP 573
            |.||. :.....|:|.:.||.......:|    ||     ..:|.|:.|.|......::|..|:.
  Rat    13 PAALA-MAQARFARGDFTEARELYSAFIGQCASHRSKCSPEDLATAYNNRGQTKYFSVDFYEAMD 76

  Fly   574 CFRRAIELRPQLAVAYLNLGTSLISLGDHRQEAI 607
            .:..|||:.|...|.|.|.|.....|| :..||:
  Rat    77 DYTSAIEILPNFEVPYYNRGLIRYRLG-YFDEAV 109

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31690	NP_995615.2	DUF1736	272..340	CDD:285594
		TPR_11	518..583	CDD:290150	19/73 (26%)
		TPR repeat	518..546	CDD:276809	7/27 (26%)
		TPR repeat	551..581	CDD:276809	8/29 (28%)
		TPR_1	552..584	CDD:278916	9/31 (29%)
		TPR	565..841	CDD:223533	14/43 (33%)
		TPR repeat	586..611	CDD:276809	8/22 (36%)
		TPR repeat	634..660	CDD:276809
		TPR repeat	671..699	CDD:276809
		TPR repeat	704..735	CDD:276809
		TPR repeat	740..768	CDD:276809
		TPR repeat	773..803	CDD:276809
		TPR	808..841	CDD:197478
		TPR repeat	808..836	CDD:276809
Ttc32	XP_003750178.1	TPR_11	14..86	CDD:290150	18/72 (25%)
		TPR repeat	14..48	CDD:276809	9/34 (26%)
		TPR repeat	53..84	CDD:276809	8/30 (27%)
		TPR_11	55..120	CDD:290150	18/56 (32%)
		TPR_1	55..88	CDD:278916	10/32 (31%)
		TPR repeat	89..117	CDD:276809	8/22 (36%)
		TPR_1	92..120	CDD:278916	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900