| Sequence 1: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_080590.3 | Gene: | Dnaaf4 / 67685 | MGIID: | 1914935 | Length: | 420 | Species: | Mus musculus |
| Alignment Length: | 270 | Identity: | 59/270 - (21%) |
|---|---|---|---|
| Similarity: | 96/270 - (35%) | Gaps: | 90/270 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 649 QDAAAALRESLKALPLLPQKQRAVLHLRLGE---ILAELQDWNE----AEHQQRLAMQLQPEQG- 705
Fly 706 ---------------AAYVTYGQTLARN------------------------------------- 718
Fly 719 GSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEAL---GLRLRAAALAPQDYTLQSCV 780
Fly 781 ADALRLLNRL-AEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHAIS 844
Fly 845 RANLARMNVH 854 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
| TPR_11 | 518..583 | CDD:290150 | |||
| TPR repeat | 518..546 | CDD:276809 | |||
| TPR repeat | 551..581 | CDD:276809 | |||
| TPR_1 | 552..584 | CDD:278916 | |||
| TPR | 565..841 | CDD:223533 | 53/255 (21%) | ||
| TPR repeat | 586..611 | CDD:276809 | |||
| TPR repeat | 634..660 | CDD:276809 | 4/10 (40%) | ||
| TPR repeat | 671..699 | CDD:276809 | 8/34 (24%) | ||
| TPR repeat | 704..735 | CDD:276809 | 11/83 (13%) | ||
| TPR repeat | 740..768 | CDD:276809 | 7/30 (23%) | ||
| TPR repeat | 773..803 | CDD:276809 | 8/30 (27%) | ||
| TPR | 808..841 | CDD:197478 | 10/32 (31%) | ||
| TPR repeat | 808..836 | CDD:276809 | 7/27 (26%) | ||
| Dnaaf4 | NP_080590.3 | Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000250 | 7..103 | ||
| p23_DYX1C1_like | 10..87 | CDD:107226 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 164..212 | 9/47 (19%) | |||
| TPR_11 | 287..351 | CDD:290150 | 22/84 (26%) | ||
| TPR 1 | 288..321 | 10/39 (26%) | |||
| TPR repeat | 288..316 | CDD:276809 | 8/34 (24%) | ||
| TPR repeat | 321..351 | CDD:276809 | 12/43 (28%) | ||
| TPR 2 | 322..355 | 14/46 (30%) | |||
| TPR_1 | 322..351 | CDD:278916 | 12/42 (29%) | ||
| TPR_12 | 324..396 | CDD:290160 | 19/59 (32%) | ||
| TPR repeat | 362..392 | CDD:276809 | 4/6 (67%) | ||
| TPR 3 | 364..397 | 2/4 (50%) | |||
| TPR_1 | 365..397 | CDD:278916 | 1/3 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||