| Sequence 1: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001278084.1 | Gene: | Tomm34 / 67145 | MGIID: | 1914395 | Length: | 309 | Species: | Mus musculus |
| Alignment Length: | 233 | Identity: | 46/233 - (19%) |
|---|---|---|---|
| Similarity: | 80/233 - (34%) | Gaps: | 72/233 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 490 VHGVRTFRRNL------DWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELTLRMTLGHR 548
Fly 549 PTMADAHFNLGVVHQKQLNFS-SAIPC---FRRAIELRPQLAVAYLNLGTSLISLGDHRQ--EAI 607
Fly 608 SVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALR---ESLKALPLLPQKQ 669
Fly 670 RAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAA 707 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
| TPR_11 | 518..583 | CDD:290150 | 12/68 (18%) | ||
| TPR repeat | 518..546 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 551..581 | CDD:276809 | 7/33 (21%) | ||
| TPR_1 | 552..584 | CDD:278916 | 8/35 (23%) | ||
| TPR | 565..841 | CDD:223533 | 31/152 (20%) | ||
| TPR repeat | 586..611 | CDD:276809 | 6/26 (23%) | ||
| TPR repeat | 634..660 | CDD:276809 | 7/28 (25%) | ||
| TPR repeat | 671..699 | CDD:276809 | 3/27 (11%) | ||
| TPR repeat | 704..735 | CDD:276809 | 2/4 (50%) | ||
| TPR repeat | 740..768 | CDD:276809 | |||
| TPR repeat | 773..803 | CDD:276809 | |||
| TPR | 808..841 | CDD:197478 | |||
| TPR repeat | 808..836 | CDD:276809 | |||
| Tomm34 | NP_001278084.1 | TPR 3 | 85..118 | ||
| TPR repeat | 85..113 | CDD:276809 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 158..189 | 5/43 (12%) | |||
| TPR_11 | 192..257 | CDD:290150 | 19/82 (23%) | ||
| TPR 4 | 193..226 | 8/40 (20%) | |||
| TPR repeat | 193..221 | CDD:276809 | 8/35 (23%) | ||
| TPR repeat | 226..256 | CDD:276809 | 9/39 (23%) | ||
| TPR 5 | 227..260 | 8/42 (19%) | |||
| TPR_1 | 229..260 | CDD:278916 | 8/40 (20%) | ||
| TPR 6 | 261..294 | 8/44 (18%) | |||
| TPR 1 | 9..42 | ||||
| TPR repeat | 9..37 | CDD:276809 | |||
| TPR_11 | 10..82 | CDD:290150 | |||
| TPR_11 | 50..115 | CDD:290150 | |||
| TPR repeat | 50..80 | CDD:276809 | |||
| TPR 2 | 51..84 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||