| Sequence 1: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001082875.2 | Gene: | spag1a / 564953 | ZFINID: | ZDB-GENE-030131-9443 | Length: | 386 | Species: | Danio rerio |
| Alignment Length: | 330 | Identity: | 66/330 - (20%) |
|---|---|---|---|
| Similarity: | 112/330 - (33%) | Gaps: | 99/330 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 514 SINPPKA-LGNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVHQKQL--NFSSAIPCF 575
Fly 576 -------------RRAIELRP-------QLAVAY----------------LNLGTSL-------- 596
Fly 597 -------------------------ISLGDHRQEAISVLRTGARLEGSGVRDRGAHVEARYTCYL 636
Fly 637 QLSVLYRSDGRLQDAAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQ 701
Fly 702 PEQGAAYVTYGQTLARNGSR-LAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLR 765
Fly 766 AAALA 770 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
| TPR_11 | 518..583 | CDD:290150 | 19/80 (24%) | ||
| TPR repeat | 518..546 | CDD:276809 | 8/28 (29%) | ||
| TPR repeat | 551..581 | CDD:276809 | 8/44 (18%) | ||
| TPR_1 | 552..584 | CDD:278916 | 11/53 (21%) | ||
| TPR | 565..841 | CDD:223533 | 54/278 (19%) | ||
| TPR repeat | 586..611 | CDD:276809 | 10/73 (14%) | ||
| TPR repeat | 634..660 | CDD:276809 | 4/25 (16%) | ||
| TPR repeat | 671..699 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 704..735 | CDD:276809 | 7/31 (23%) | ||
| TPR repeat | 740..768 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 773..803 | CDD:276809 | |||
| TPR | 808..841 | CDD:197478 | |||
| TPR repeat | 808..836 | CDD:276809 | |||
| spag1a | NP_001082875.2 | TPR_11 | 87..157 | CDD:290150 | 17/76 (22%) |
| TPR repeat | 87..112 | CDD:276809 | 7/31 (23%) | ||
| TPR repeat | 125..155 | CDD:276809 | 6/29 (21%) | ||
| TPR_11 | 128..190 | CDD:290150 | 12/61 (20%) | ||
| TPR repeat | 160..188 | CDD:276809 | 3/27 (11%) | ||
| TPR_11 | 263..326 | CDD:290150 | 11/67 (16%) | ||
| TPR repeat | 263..289 | CDD:276809 | 4/25 (16%) | ||
| TPR repeat | 294..324 | CDD:276809 | 4/29 (14%) | ||
| TPR_11 | 297..360 | CDD:290150 | 15/64 (23%) | ||
| TPR_1 | 297..328 | CDD:278916 | 6/30 (20%) | ||
| TPR repeat | 329..357 | CDD:276809 | 6/29 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||