DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and ogt

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:XP_012823955.1 Gene:ogt / 553157 XenbaseID:XB-GENE-966145 Length:1045 Species:Xenopus tropicalis


Alignment Length:465 Identity:123/465 - (26%)
Similarity:183/465 - (39%) Gaps:107/465 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 SAIYSTSSKSKSASWTAAPILGTAFLVLPFLPASNLLFYVGFVMAERVLYLPSVGYCLLFGLGFG 464
            ||.:||.:..::      |:|..|:        |||    |.|..||                 |
 Frog    74 SAHFSTLAIKQN------PLLAEAY--------SNL----GNVYKER-----------------G 103

  Fly   465 HLWQRVNSSWRSRLML-------LCGLALLLGVHGVRTFRRNLDWRDEEQLFRSAISINPPK--A 520
            .| |.....:|..|.|       ...||..|...|        |.....|.:.||:..||..  .
 Frog   104 QL-QEAIEHYRHALRLKPDFIDGYINLAAALVAAG--------DMEGAVQAYVSALQYNPDLYCV 159

  Fly   521 LGNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQL 585
            ..:||::|.|.||.|||:......:..:|..|.|..|||.|...|.....||..|.:|:.|.|..
 Frog   160 RSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF 224

  Fly   586 AVAYLNLGTSLISLGDHRQEAISVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQD 650
            ..||:|||..|                                               .:.|:.|
 Frog   225 LDAYINLGNVL-----------------------------------------------KEARIFD 242

  Fly   651 AAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYGQTL 715
            .|.|  ..|:||.|.|  ..||:|..|..:..|....:.|....|.|::|||....||......|
 Frog   243 RAVA--AYLRALSLSP--NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANAL 303

  Fly   716 ARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQSCV 780
            ...|| :.:||..:..||:|.|....|.::.|:...:|....||:.|..:|..:.|:.....|.:
 Frog   304 KEKGS-VVDAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNL 367

  Fly   781 ADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHAISR 845
            |..|:...:|.||.:.|::|:.:.|..|.|::|:|..|:.....:.|:.||.:|:::.|..|.:.
 Frog   368 ASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAH 432

  Fly   846 ANLARMNVHK 855
            :|||  ::||
 Frog   433 SNLA--SIHK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 22/66 (33%)
TPR repeat 518..546 CDD:276809 9/29 (31%)
TPR repeat 551..581 CDD:276809 11/29 (38%)
TPR_1 552..584 CDD:278916 12/31 (39%)
TPR 565..841 CDD:223533 71/275 (26%)
TPR repeat 586..611 CDD:276809 6/24 (25%)
TPR repeat 634..660 CDD:276809 4/25 (16%)
TPR repeat 671..699 CDD:276809 8/27 (30%)
TPR repeat 704..735 CDD:276809 9/30 (30%)
TPR repeat 740..768 CDD:276809 7/27 (26%)
TPR repeat 773..803 CDD:276809 8/29 (28%)
TPR 808..841 CDD:197478 10/32 (31%)
TPR repeat 808..836 CDD:276809 9/27 (33%)
ogtXP_012823955.1 PEP_TPR_lipo <22..>465 CDD:274350 123/465 (26%)
TPR repeat 24..49 CDD:276809
TPR repeat 57..83 CDD:276809 4/8 (50%)
TPR repeat 89..117 CDD:276809 12/57 (21%)
TPR repeat 122..152 CDD:276809 8/37 (22%)
TPR repeat 157..185 CDD:276809 9/27 (33%)
TPR repeat 191..219 CDD:276809 11/27 (41%)
TPR repeat 226..253 CDD:276809 12/75 (16%)
TPR repeat 259..287 CDD:276809 8/27 (30%)
TPR repeat 293..321 CDD:276809 8/28 (29%)
TPR repeat 327..355 CDD:276809 7/27 (26%)
TPR repeat 360..390 CDD:276809 8/29 (28%)
TPR repeat 395..423 CDD:276809 9/27 (33%)
TPR repeat 429..457 CDD:276809 6/14 (43%)
Glyco_transf_41 556..1023 CDD:372753
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.