DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc1 and LOC4577322

DIOPT Version :10

Sequence 1:NP_995615.2 Gene:Tmtc1 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:XP_001238468.2 Gene:LOC4577322 / 4577322 VectorBaseID:AGAMI1_013727 Length:420 Species:Anopheles gambiae


Alignment Length:210 Identity:55/210 - (26%)
Similarity:76/210 - (36%) Gaps:68/210 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   690 AEHQQRLAMQLQP----EQGAAYVTYGQ----TLARNGSRLAEAESW------FKRALQLA--PL 738
            ::.||.|.....|    ..|...||:.:    |..|.....||.| |      .:||:..|  .|
Mosquito   213 SDQQQELPRPSSPPAIRRSGTLEVTFSERTFVTPKRESMEQAEQE-WTLKQAAARRAVGFADDDL 276

  Fly   739 EPSSHHHYADFLEQ------QERH-----------------HEALGLRLRAAALAPQDYTLQSCV 780
            .|...:  .::|:|      |:|:                 :.||.|...||.||.::|  |.|.
Mosquito   277 RPDERN--PEWLKQRGDTFFQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALENY--QRCA 337

  Fly   781 AD---ALRLL------NRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALE 836
            .|   ||.||      ||.|......|:|..|        ..||.:.|  |. :|.:|    |..
Mosquito   338 EDCSTALELLQPPVEANRRARVACLARRAAAL--------VKLGFLQQ--GY-EEMIA----ASR 387

  Fly   837 LQPGHAISRANLARM 851
            |.|..|..|..:.|:
Mosquito   388 LDPDEASLRLEVDRL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc1NP_995615.2 ArnT 11..>209 CDD:441412
TMTC_DUF1736 271..340 CDD:462468
PilF 501..585 CDD:442297
TPR repeat 518..546 CDD:276809
TPR repeat 551..581 CDD:276809
LapB 556..838 CDD:442196 50/195 (26%)
TPR repeat 586..611 CDD:276809
TPR repeat 634..660 CDD:276809
TPR repeat 671..699 CDD:276809 3/8 (38%)
TPR repeat 704..735 CDD:276809 11/40 (28%)
TPR repeat 740..768 CDD:276809 9/50 (18%)
TPR repeat 773..803 CDD:276809 13/38 (34%)
TPR repeat 808..836 CDD:276809 7/27 (26%)
LOC4577322XP_001238468.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.