DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and IFIT1B

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001010987.1 Gene:IFIT1B / 439996 HGNCID:23442 Length:474 Species:Homo sapiens


Alignment Length:445 Identity:91/445 - (20%)
Similarity:157/445 - (35%) Gaps:125/445 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 LGVHGVRTFRRNLDWRDEEQLFRSAISINPPKAL-----------------GNLGSVLSAQGRYE 535
            :|:|.:..:.::|..::||.|    :|:...:.|                 ||...|....||..
Human    52 VGIHNLLAYVKHLKGQNEEAL----VSLKKAEDLIQKEHANQADIRSLVTWGNFAWVYYHMGRLA 112

  Fly   536 EAELTL--------RMTLGHRPTM----ADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQ---- 584
            ||:..|        :.....|..|    .|......:......|:..|..||.:|:|..|:    
Human   113 EAQTYLDKVENTCKKFANPSRYRMECPEVDCEEGWALAKCGGKNYERAKTCFEKALEGNPENPEF 177

  Fly   585 ---LAVAYLNLGTSLISLGDHRQEAISVLRTGARLEGSGV----------RDRGAHVEARYTCYL 636
               .|:....|.....:.|.::..::.||:...||....|          :|.|...|...  |:
Human   178 NTGYAITVYRLDKFNTASGRNKAFSLHVLKRAVRLNPDDVYIRVLLALKLQDEGQEAEGEK--YI 240

  Fly   637 QLSV---------------LYRSDGRLQDAAAALRESLKALPLLPQKQRAVLHLRLGEI------ 680
            :.::               .||..|.:..|...|:.:|:..|     ..|.||.::|..      
Human   241 EEALTSISSQAYVFQYAAKFYRRKGSVDKALELLKMALETTP-----TSAFLHHQMGLCYRAQMI 300

  Fly   681 -LAELQDW----NEAEHQQRL----------AMQLQPEQGAAYVTYGQTLARNGSRLAEAESWFK 730
             :.|..:|    .:.|...||          .:.|:.....|||...:|.|..|.. .:||..|:
Human   301 QIKEATNWQPRGQDRETVDRLVQLAICKFEKTIMLKRTFEMAYVDLAETYAEIGHH-RKAEEHFQ 364

  Fly   731 RALQLA----PLEPSSHHHYADFLEQQERH---------HEALGLRLRAAALAPQDYTLQSCVAD 782
            :.|::.    .|:...|:||..|   ||.|         |...||::...:.:.:          
Human   365 KGLRMKIFEDQLKQEIHYHYGRF---QEHHGKSQDKAITHYLKGLKIEKMSHSRE---------- 416

  Fly   783 ALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALEL 837
              :|||.|   |...::.:........:.:.||.|.:::|...:|:.||.:||.|
Human   417 --KLLNAL---EKLAKRCIHQNVRVVESVSLLGLIHKLKGEVSDALLCYERALRL 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 18/93 (19%)
TPR repeat 518..546 CDD:276809 9/52 (17%)
TPR repeat 551..581 CDD:276809 7/33 (21%)
TPR_1 552..584 CDD:278916 7/31 (23%)
TPR 565..841 CDD:223533 72/339 (21%)
TPR repeat 586..611 CDD:276809 4/24 (17%)
TPR repeat 634..660 CDD:276809 6/40 (15%)
TPR repeat 671..699 CDD:276809 9/48 (19%)
TPR repeat 704..735 CDD:276809 10/30 (33%)
TPR repeat 740..768 CDD:276809 10/36 (28%)
TPR repeat 773..803 CDD:276809 5/29 (17%)
TPR 808..841 CDD:197478 10/30 (33%)
TPR repeat 808..836 CDD:276809 8/27 (30%)
IFIT1BNP_001010987.1 TPR_11 36..>298 CDD:330823 49/256 (19%)
TPR 1 52..85 8/36 (22%)
TPR repeat 54..80 CDD:276809 6/29 (21%)
TPR 2 95..128 8/32 (25%)
TPR repeat 97..123 CDD:276809 8/25 (32%)
TPR repeat 128..170 CDD:276809 8/41 (20%)
TPR 3 139..174 8/34 (24%)
TPR 4 182..216 7/33 (21%)
TPR repeat 216..246 CDD:276809 5/31 (16%)
TPR 5 251..284 7/37 (19%)
TPR repeat 251..279 CDD:276809 5/27 (19%)
TPR repeat 284..335 CDD:276809 9/50 (18%)
TPR_11 <323..469 CDD:330823 37/163 (23%)
TPR 6 340..373 10/33 (30%)
TPR repeat 340..368 CDD:276809 9/28 (32%)
TPR 7 378..412 10/36 (28%)
TPR repeat 378..407 CDD:276809 9/31 (29%)
TPR 8 437..470 10/30 (33%)
TPR repeat 437..465 CDD:276809 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.