Sequence 1: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651514.1 | Gene: | Spag1 / 43239 | FlyBaseID: | FBgn0039463 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 44/195 - (22%) |
---|---|---|---|
Similarity: | 69/195 - (35%) | Gaps: | 46/195 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 679 EILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYGQTLARNGSRLAEAESWFKR-ALQLAPLEPSS 742
Fly 743 HHHYADFLEQQERHHEALGLRLRAAAL--------APQDYTLQSCVAD---ALRLLNRLAEAELW 796
Fly 797 YRK----------AVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHAISRANLARM 851
Fly 852 851 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
TPR_11 | 518..583 | CDD:290150 | |||
TPR repeat | 518..546 | CDD:276809 | |||
TPR repeat | 551..581 | CDD:276809 | |||
TPR_1 | 552..584 | CDD:278916 | |||
TPR | 565..841 | CDD:223533 | 42/183 (23%) | ||
TPR repeat | 586..611 | CDD:276809 | |||
TPR repeat | 634..660 | CDD:276809 | |||
TPR repeat | 671..699 | CDD:276809 | 7/19 (37%) | ||
TPR repeat | 704..735 | CDD:276809 | 4/31 (13%) | ||
TPR repeat | 740..768 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 773..803 | CDD:276809 | 9/42 (21%) | ||
TPR | 808..841 | CDD:197478 | 8/32 (25%) | ||
TPR repeat | 808..836 | CDD:276809 | 6/27 (22%) | ||
Spag1 | NP_651514.1 | TPR_11 | 229..295 | CDD:290150 | 17/78 (22%) |
TPR repeat | 229..257 | CDD:276809 | 10/40 (25%) | ||
TPR repeat | 262..293 | CDD:276809 | 6/30 (20%) | ||
TPR_11 | 266..329 | CDD:290150 | 14/62 (23%) | ||
TPR | 266..297 | CDD:197478 | 6/30 (20%) | ||
TPR repeat | 298..326 | CDD:276809 | 6/27 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |