DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31690 and CG14921

DIOPT Version :9

Sequence 1:	NP_995615.2	Gene:	CG31690 / 33455	FlyBaseID:	FBgn0051690	Length:	859	Species:	Drosophila melanogaster
Sequence 2:	NP_609491.1	Gene:	CG14921 / 34547	FlyBaseID:	FBgn0032345	Length:	240	Species:	Drosophila melanogaster

Alignment Length:	141	Identity:	32/141 - (22%)
Similarity:	54/141 - (38%)	Gaps:	37/141 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   641 LYRSDGRLQDAAAALRESLKAL-PLLPQK--QRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQP 702
            :::::.|:     .|.:..|.| |.:.||  :.|::..|| ||...:.:.|:...::.|...
  Fly    60 IFKNEARI-----VLVKKEKGLWPEMFQKLDKEALMQKRL-EIADLIVERNKKRDEKALERY--- 115

  Fly   703 EQGAAYVTYGQTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAA 767
                           :..|.||.:...:|       |.........|.|...|  |||.:.:|..
  Fly   116 ---------------DNKRRAEIQKEIQR-------ETDMRERVKQFQENSVR--EALVVDVRKE 156

  Fly   768 ALA-PQDYTLQ 777
            |.| |:..|||
  Fly   157 AKATPKPDTLQ 167

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31690	NP_995615.2	DUF1736	272..340	CDD:285594
		TPR_11	518..583	CDD:290150
		TPR repeat	518..546	CDD:276809
		TPR repeat	551..581	CDD:276809
		TPR_1	552..584	CDD:278916
		TPR	565..841	CDD:223533	32/141 (23%)
		TPR repeat	586..611	CDD:276809
		TPR repeat	634..660	CDD:276809	2/18 (11%)
		TPR repeat	671..699	CDD:276809	7/27 (26%)
		TPR repeat	704..735	CDD:276809	4/30 (13%)
		TPR repeat	740..768	CDD:276809	7/27 (26%)
		TPR repeat	773..803	CDD:276809	3/5 (60%)
		TPR	808..841	CDD:197478
		TPR repeat	808..836	CDD:276809
CG14921	NP_609491.1	p23_DYX1C1_like	4..81	CDD:107226	5/25 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900