| Sequence 1: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001026853.1 | Gene: | IFIT3 / 3437 | HGNCID: | 5411 | Length: | 490 | Species: | Homo sapiens |
| Alignment Length: | 246 | Identity: | 49/246 - (19%) |
|---|---|---|---|
| Similarity: | 89/246 - (36%) | Gaps: | 48/246 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 627 HVEARYTCYLQLSVLYRSDGRLQDAAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAE 691
Fly 692 ----HQQRLA------------------------MQLQPEQGAAYVTYGQTLARNGSRLAEAESW 728
Fly 729 FKRALQLAPLEPSSHHHYADFLEQQERHHE---ALGLRLRAAALAPQDYTLQSCVADALRLLNRL 790
Fly 791 AEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGH 841 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
| TPR_11 | 518..583 | CDD:290150 | |||
| TPR repeat | 518..546 | CDD:276809 | |||
| TPR repeat | 551..581 | CDD:276809 | |||
| TPR_1 | 552..584 | CDD:278916 | |||
| TPR | 565..841 | CDD:223533 | 49/244 (20%) | ||
| TPR repeat | 586..611 | CDD:276809 | |||
| TPR repeat | 634..660 | CDD:276809 | 7/25 (28%) | ||
| TPR repeat | 671..699 | CDD:276809 | 8/55 (15%) | ||
| TPR repeat | 704..735 | CDD:276809 | 7/30 (23%) | ||
| TPR repeat | 740..768 | CDD:276809 | 5/30 (17%) | ||
| TPR repeat | 773..803 | CDD:276809 | 6/29 (21%) | ||
| TPR | 808..841 | CDD:197478 | 5/32 (16%) | ||
| TPR repeat | 808..836 | CDD:276809 | 2/27 (7%) | ||
| IFIT3 | NP_001026853.1 | TPR_12 | 51..126 | CDD:290160 | 19/83 (23%) |
| TPR 1 | 51..84 | 10/35 (29%) | |||
| TPR repeat | 51..79 | CDD:276809 | 9/30 (30%) | ||
| TPR repeat | 84..123 | CDD:276809 | 8/44 (18%) | ||
| TPR 2 | 94..127 | 5/32 (16%) | |||
| TPR 3 | 136..169 | 10/40 (25%) | |||
| TPR repeat | 136..164 | CDD:276809 | 8/35 (23%) | ||
| TPR_19 | 150..213 | CDD:291240 | 14/70 (20%) | ||
| TPR 4 | 172..206 | 6/33 (18%) | |||
| PRK02603 | 184..341 | CDD:179448 | 17/91 (19%) | ||
| TPR repeat | 206..236 | CDD:276809 | 6/29 (21%) | ||
| TPR 5 | 207..240 | 7/32 (22%) | |||
| TPR 6 | 241..274 | 5/32 (16%) | |||
| TPR repeat | 241..269 | CDD:276809 | 2/27 (7%) | ||
| TPR 7 | 415..448 | ||||
| TPR 8 | 450..481 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 467..490 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||