DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and BBS8

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_608524.1 Gene:BBS8 / 33217 FlyBaseID:FBgn0031255 Length:549 Species:Drosophila melanogaster


Alignment Length:480 Identity:99/480 - (20%)
Similarity:155/480 - (32%) Gaps:104/480 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 WGMEAVSRIRTLWDAR-NILTAGFYGSLVAILWKGSGLRSAASPMDFAEVANISLP--------- 367
            |.||.|      |..: ..||...|   |..|.:..|...|...::|..:|..:.|         
  Fly   101 WLMEGV------WQLKMRALTQRVY---VDDLDEDDGGNEATEEVEFERIATAARPGSSIKTAFQ 156

  Fly   368 ----------LLRRLGGNSCHTWLGLTCDCHHQLSAPSYRSASAIYSTSSKSKSASWTAAPILGT 422
                      ..|..|....|:..| ..:.....||...|..:::....|...|...||:.|..|
  Fly   157 PRPLTSQRAQQARSRGAGVAHSSDG-RLNSSRPGSAAVARPGTSLSRPGSSLGSRCGTASRIRAT 220

  Fly   423 AFLVLPFLPASNLLFYVG----FVMAERVLYLPSVGYCLLFGLGFGH---------LWQRV---- 470
            :........|::.|:...    .:.|||...:.:     ||...:.|         |.|.|    
  Fly   221 SAAAFNVGDATSKLYQASRLNPTIYAERETLVKA-----LFQFLYYHEADVQKAHSLCQAVLEVE 280

  Fly   471 -----------NSSWRSRLMLLCGLALLLGVHGVRTFRRNLDWRDEEQLFRSAISINPPKALGNL 524
                       .|.|..:.|..|    ||.:|..|        |.|..|.:|..|...|.....|
  Fly   281 RQKPSGSTGCTLSWWWQQQMGRC----LLALHYPR--------RAEPFLQQSLTSFPHPDTYLLL 333

  Fly   525 GSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRP------ 583
            ..|.....:.|.|.|.:...:..||...........:||.......|:..:|.|.:|.|      
  Fly   334 SRVYQRIKQPERALLVIGEVVDSRPFDVTYRLEQARIHQAMEQQEDALQLYRLAAKLHPINVESL 398

  Fly   584 -QLAVAYLNLGTSLISLGDHRQEAISVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGR 647
             .:||.|.......::|..:|:    :|..||:             .....|.:.|..||  .|:
  Fly   399 ASIAVGYFYDNNPEMALMYYRR----ILSLGAQ-------------SPELYCNIALCCLY--GGQ 444

  Fly   648 LQDAAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYG 712
            :.......:.:| |....| .|::.:...|..:.....|:|.|:...:|.:....:.|||.....
  Fly   445 IDLVLPCFQRAL-ATATQP-GQKSDIWYNLSFVAVTSGDFNLAKRCLQLCLTSDAQNGAALNNLA 507

  Fly   713 QTLARNGSRLAEAESWFKRALQLAP 737
            ...|::|..|. |:|:...|..:.|
  Fly   508 VLAAQSGDILG-AKSYLNAAKDVMP 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594 8/27 (30%)
TPR_11 518..583 CDD:290150 14/64 (22%)
TPR repeat 518..546 CDD:276809 6/27 (22%)
TPR repeat 551..581 CDD:276809 5/29 (17%)
TPR_1 552..584 CDD:278916 7/38 (18%)
TPR 565..841 CDD:223533 37/180 (21%)
TPR repeat 586..611 CDD:276809 5/24 (21%)
TPR repeat 634..660 CDD:276809 5/25 (20%)
TPR repeat 671..699 CDD:276809 5/27 (19%)
TPR repeat 704..735 CDD:276809 9/30 (30%)
TPR repeat 740..768 CDD:276809
TPR repeat 773..803 CDD:276809
TPR 808..841 CDD:197478
TPR repeat 808..836 CDD:276809
BBS8NP_608524.1 TPR repeat 299..322 CDD:276809 10/34 (29%)
TPR repeat 327..355 CDD:276809 6/27 (22%)
TPR_16 331..392 CDD:290168 13/60 (22%)
TPR repeat 365..389 CDD:276809 5/23 (22%)
Coatomer_WDAD <378..519 CDD:281977 33/162 (20%)
TPR_11 394..457 CDD:290150 14/82 (17%)
TPR repeat 394..424 CDD:276809 6/33 (18%)
TPR repeat 429..457 CDD:276809 6/30 (20%)
TPR_11 465..526 CDD:290150 13/61 (21%)
TPR repeat 466..493 CDD:276809 5/26 (19%)
TPR repeat 500..526 CDD:276809 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467046
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.