Sequence 1: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012116.1 | Gene: | Spag1 / 315033 | RGDID: | 1310702 | Length: | 893 | Species: | Rattus norvegicus |
Alignment Length: | 386 | Identity: | 86/386 - (22%) |
---|---|---|---|
Similarity: | 119/386 - (30%) | Gaps: | 142/386 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 516 NPPKALGNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIE 580
Fly 581 LRP-------QLAVAYLNLGTSLISLGDHRQ-------------------------EAISVLRT- 612
Fly 613 GARL-----EGSGVRDRGAH----------VEARYTCYLQLSVLYRSDGRLQDAAAALRESLKAL 662
Fly 663 PLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYV------------------ 709
Fly 710 -TYGQTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQD 773
Fly 774 YTLQSCVADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKA 834 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
TPR_11 | 518..583 | CDD:290150 | 21/64 (33%) | ||
TPR repeat | 518..546 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 551..581 | CDD:276809 | 8/29 (28%) | ||
TPR_1 | 552..584 | CDD:278916 | 11/38 (29%) | ||
TPR | 565..841 | CDD:223533 | 70/337 (21%) | ||
TPR repeat | 586..611 | CDD:276809 | 7/49 (14%) | ||
TPR repeat | 634..660 | CDD:276809 | 6/25 (24%) | ||
TPR repeat | 671..699 | CDD:276809 | 3/27 (11%) | ||
TPR repeat | 704..735 | CDD:276809 | 10/49 (20%) | ||
TPR repeat | 740..768 | CDD:276809 | 4/27 (15%) | ||
TPR repeat | 773..803 | CDD:276809 | 4/29 (14%) | ||
TPR | 808..841 | CDD:197478 | 5/27 (19%) | ||
TPR repeat | 808..836 | CDD:276809 | 5/27 (19%) | ||
Spag1 | NP_001012116.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..155 | ||
3a0801s09 | 141..>303 | CDD:273380 | 26/92 (28%) | ||
TPR 1 | 213..246 | 12/35 (34%) | |||
TPR repeat | 217..241 | CDD:276809 | 8/26 (31%) | ||
TPR repeat | 246..275 | CDD:276809 | 8/28 (29%) | ||
TPR 2 | 247..279 | 10/31 (32%) | |||
TPR 3 | 280..313 | 5/32 (16%) | |||
TPR repeat | 280..308 | CDD:276809 | 5/27 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 324..344 | 6/19 (32%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 349..368 | 5/20 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 373..437 | 16/98 (16%) | |||
TPR 4 | 429..463 | 12/36 (33%) | |||
3a0801s09 | <432..>569 | CDD:273380 | 30/127 (24%) | ||
TPR repeat | 432..458 | CDD:276809 | 8/28 (29%) | ||
TPR repeat | 466..500 | CDD:276809 | 8/47 (17%) | ||
TPR 5 | 471..504 | 10/46 (22%) | |||
TPR repeat | 505..533 | CDD:276809 | 5/27 (19%) | ||
TPR 6 | 506..538 | 5/26 (19%) | |||
3a0801s09 | 569..>695 | CDD:273380 | |||
TPR 7 | 605..638 | ||||
TPR repeat | 606..633 | CDD:276809 | |||
TPR repeat | 638..668 | CDD:276809 | |||
TPR 8 | 639..672 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 704..756 | ||||
RPAP3_C | 769..858 | CDD:404718 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |