DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc1 and Bbs4

DIOPT Version :10

Sequence 1:NP_995615.2 Gene:Tmtc1 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001100296.1 Gene:Bbs4 / 300754 RGDID:1309134 Length:520 Species:Rattus norvegicus


Alignment Length:402 Identity:82/402 - (20%)
Similarity:139/402 - (34%) Gaps:99/402 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 LLGVHGVRTFRRNLDWRDEEQLFRSAISINPP--KALGNLGSVLSAQGRYEEAELTLRMTL---G 546
            |||.|...|           :::..|..:|..  :...|||...:...::.:|:..|...|   .
  Rat   113 LLGKHKAAT-----------EVYNEAAKLNQKDWEICHNLGVCYTYLKQFSKAQDQLHSALQLNK 166

  Fly   547 HRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQEAISVLR 611
            |..|    :..||.:|..|.:...||..:::|:|..|:.......||...:.||.: |:|...| 
  Rat   167 HDLT----YIMLGKIHLLQGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGVY-QKAFEHL- 225

  Fly   612 TGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRESLKALPLLPQ--------- 667
                  |:.:    .:..|.|...|....:.::.|....|....|....|:|..|.         
  Rat   226 ------GNAL----TYDPANYKAILAAGSMMQTHGDFDVALTKYRVVACAIPESPPLWNNIGMCF 280

  Fly   668 --KQRAVLHL------------------RLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYG 712
              |::.|..:                  .||.:...:|.:..|.|....|:..||:.|..|:...
  Rat   281 FGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLA 345

  Fly   713 QTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALG----LRLRAAALA--- 770
            ..|. |...:..|:..:..|::|....|..:.:||..|..|.....||.    :..:...|.   
  Rat   346 VALT-NLEDIENAKRAYVEAVRLDKCNPLVNLNYAVLLYNQGEKKGALAQYQEMEKKVHFLKDNN 409

  Fly   771 PQDYTLQSC-VADALRLLNRLAEAELWYR---------------KAVTL-QPM------------ 806
            |.::..:.. :|..|....::.||.:|.:               |:.|| ||:            
  Rat   410 PLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHRTNSGSKSATLQQPLGSFQALGQAMSS 474

  Fly   807 -AAHAHANLGAI 817
             |||.....||:
  Rat   475 AAAHRKIPSGAV 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc1NP_995615.2 ArnT 11..>209 CDD:441412
TMTC_DUF1736 271..340 CDD:462468
PilF 501..585 CDD:442297 19/88 (22%)
TPR repeat 518..546 CDD:276809 6/32 (19%)
TPR repeat 551..581 CDD:276809 7/29 (24%)
LapB 556..838 CDD:442196 67/328 (20%)
TPR repeat 586..611 CDD:276809 6/24 (25%)
TPR repeat 634..660 CDD:276809 4/25 (16%)
TPR repeat 671..699 CDD:276809 7/45 (16%)
TPR repeat 704..735 CDD:276809 6/30 (20%)
TPR repeat 740..768 CDD:276809 7/31 (23%)
TPR repeat 773..803 CDD:276809 6/45 (13%)
TPR repeat 808..836 CDD:276809 4/10 (40%)
Bbs4NP_001100296.1 TPR repeat 68..95 CDD:276809
LapB 71..332 CDD:442196 49/245 (20%)
TPR repeat 101..129 CDD:276809 6/26 (23%)
TPR repeat 134..164 CDD:276809 6/29 (21%)
TPR repeat 169..196 CDD:276809 8/30 (27%)
TPR repeat 202..229 CDD:276809 8/34 (24%)
TPR repeat 236..264 CDD:276809 5/27 (19%)
Spy 250..>448 CDD:443119 37/198 (19%)
TPR repeat 270..298 CDD:276809 3/27 (11%)
TPR repeat 303..333 CDD:276809 6/29 (21%)
TPR repeat 338..366 CDD:276809 6/28 (21%)
TPR repeat 372..397 CDD:276809 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.