DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and Bbs4

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:XP_038937022.1 Gene:Bbs4 / 300754 RGDID:1309134 Length:529 Species:Rattus norvegicus


Alignment Length:402 Identity:82/402 - (20%)
Similarity:139/402 - (34%) Gaps:99/402 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 LLGVHGVRTFRRNLDWRDEEQLFRSAISINPP--KALGNLGSVLSAQGRYEEAELTLRMTL---G 546
            |||.|...|           :::..|..:|..  :...|||...:...::.:|:..|...|   .
  Rat   122 LLGKHKAAT-----------EVYNEAAKLNQKDWEICHNLGVCYTYLKQFSKAQDQLHSALQLNK 175

  Fly   547 HRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQEAISVLR 611
            |..|    :..||.:|..|.:...||..:::|:|..|:.......||...:.||.: |:|...| 
  Rat   176 HDLT----YIMLGKIHLLQGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGVY-QKAFEHL- 234

  Fly   612 TGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRESLKALPLLPQ--------- 667
                  |:.:    .:..|.|...|....:.::.|....|....|....|:|..|.         
  Rat   235 ------GNAL----TYDPANYKAILAAGSMMQTHGDFDVALTKYRVVACAIPESPPLWNNIGMCF 289

  Fly   668 --KQRAVLHL------------------RLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYG 712
              |::.|..:                  .||.:...:|.:..|.|....|:..||:.|..|:...
  Rat   290 FGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLA 354

  Fly   713 QTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALG----LRLRAAALA--- 770
            ..|. |...:..|:..:..|::|....|..:.:||..|..|.....||.    :..:...|.   
  Rat   355 VALT-NLEDIENAKRAYVEAVRLDKCNPLVNLNYAVLLYNQGEKKGALAQYQEMEKKVHFLKDNN 418

  Fly   771 PQDYTLQSC-VADALRLLNRLAEAELWYR---------------KAVTL-QPM------------ 806
            |.::..:.. :|..|....::.||.:|.:               |:.|| ||:            
  Rat   419 PLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHRTNSGSKSATLQQPLGSFQALGQAMSS 483

  Fly   807 -AAHAHANLGAI 817
             |||.....||:
  Rat   484 AAAHRKIPSGAV 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 16/69 (23%)
TPR repeat 518..546 CDD:276809 6/32 (19%)
TPR repeat 551..581 CDD:276809 7/29 (24%)
TPR_1 552..584 CDD:278916 8/31 (26%)
TPR 565..841 CDD:223533 64/319 (20%)
TPR repeat 586..611 CDD:276809 6/24 (25%)
TPR repeat 634..660 CDD:276809 4/25 (16%)
TPR repeat 671..699 CDD:276809 7/45 (16%)
TPR repeat 704..735 CDD:276809 6/30 (20%)
TPR repeat 740..768 CDD:276809 7/31 (23%)
TPR repeat 773..803 CDD:276809 6/45 (13%)
TPR 808..841 CDD:197478 4/10 (40%)
TPR repeat 808..836 CDD:276809 4/10 (40%)
Bbs4XP_038937022.1 PEP_TPR_lipo <31..442 CDD:274350 69/347 (20%)
TPR repeat 77..104 CDD:276809
TPR repeat 110..138 CDD:276809 6/26 (23%)
TPR repeat 143..173 CDD:276809 6/29 (21%)
TPR repeat 178..205 CDD:276809 8/30 (27%)
TPR repeat 211..238 CDD:276809 8/34 (24%)
TPR repeat 245..273 CDD:276809 5/27 (19%)
TPR repeat 279..307 CDD:276809 3/27 (11%)
TPR repeat 312..342 CDD:276809 6/29 (21%)
TPR repeat 347..375 CDD:276809 6/28 (21%)
TPR repeat 381..406 CDD:276809 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.