DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and Ifit1bl

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:XP_220058.2 Gene:Ifit1bl / 294090 RGDID:1304872 Length:473 Species:Rattus norvegicus


Alignment Length:452 Identity:87/452 - (19%)
Similarity:158/452 - (34%) Gaps:140/452 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 LGVHGVRTFRRNLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELTLR--MTLG---- 546
            :|:|.:..:.|:|....||.                |.|:..|:...|..:|..|  :|.|    
  Rat    60 MGMHNLMAYVRHLKGEQEEA----------------LQSLKEAEALIEGEQLGKRSLVTWGNCAW 108

  Fly   547 ---HRPTMADAHFNLGVVHQKQLNFSS-----------------------------AIPCFRRAI 579
               ||.::|:|...|..|......|:|                             |:.||.:|:
  Rat   109 VHYHRGSLAEAQIYLDKVENVCREFASPFRYRMECAEIDCEEGWALLKCGGSNCTRAMACFAKAL 173

  Fly   580 ELRPQLAVAYLNLGTSLISLGDHRQEAISVLRTGAR---------------LEGSGVRDRG-AHV 628
            :..|:..........:...:....:.::..||...|               |:..|.:|.. .|:
  Rat   174 QEEPENPEYNAGYAITAFRMDFSNEISLEPLRKAVRLNPEDPHLKVLLALKLQDLGKQDEAEKHI 238

  Fly   629 E-------ARYTCYLQLSVLYRSDGRLQDAAAALRESLKALPLLPQKQRAVLHLRLG-------- 678
            |       :|...:..::..||..|.:::|...|..:||..|     ....||.::|        
  Rat   239 EEALPKIPSRNNIFGYVAKFYRRKGCVEEALEFLERALKTKP-----SSVYLHFQIGLCHKSRVF 298

  Fly   679 ------EILAELQDWNEAEHQQRLA-------MQLQPEQGAAYVTYGQTLARNGSRLAEAESWFK 730
                  .:..:.:|...|:...|.|       :.|:|....||:...:..|.: .:..|||..|:
  Rat   299 QIKEATNMHPKGKDRERADQSIRSAIYYFEKTLDLKPTYERAYIDLAEMYAES-KQFEEAEEAFQ 362

  Fly   731 RALQL-----APLEPSSHHHYADFLEQQERH---------HEALGLRLRAAALAPQDYTLQSCVA 781
            :.|.:     ..::...|..|..|   |:.|         |...||::...::...         
  Rat   363 KVLSMLSNLEVHMQQEIHFRYGKF---QQFHMKSENIAITHYLKGLKIEVTSIFRD--------- 415

  Fly   782 DALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKAL----ELQP 839
            ..|:.|.:|||..: .:....|:.::.     ||.:.:::|..::|::||.|||    ||.|
  Rat   416 KLLKALQKLAERRM-QQNVHVLESLSL-----LGFVYRLKGDTRKAMSCYEKALRLTEELNP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 20/102 (20%)
TPR repeat 518..546 CDD:276809 7/29 (24%)
TPR repeat 551..581 CDD:276809 10/58 (17%)
TPR_1 552..584 CDD:278916 10/60 (17%)
TPR 565..841 CDD:223533 67/366 (18%)
TPR repeat 586..611 CDD:276809 0/24 (0%)
TPR repeat 634..660 CDD:276809 5/25 (20%)
TPR repeat 671..699 CDD:276809 7/48 (15%)
TPR repeat 704..735 CDD:276809 8/30 (27%)
TPR repeat 740..768 CDD:276809 8/36 (22%)
TPR repeat 773..803 CDD:276809 5/29 (17%)
TPR 808..841 CDD:197478 12/36 (33%)
TPR repeat 808..836 CDD:276809 9/31 (29%)
Ifit1blXP_220058.2 TPR_12 62..132 CDD:290160 19/85 (22%)
TNFRSF <124..>167 CDD:304602 4/42 (10%)
TPR repeat 144..174 CDD:276809 4/29 (14%)
TPR_11 214..280 CDD:290150 13/65 (20%)
TPR repeat 214..244 CDD:276809 5/29 (17%)
TPR repeat 282..333 CDD:276809 7/50 (14%)
TPR repeat 338..366 CDD:276809 7/28 (25%)
TPR repeat 371..406 CDD:276809 7/37 (19%)
TPR repeat 412..464 CDD:276809 14/66 (21%)
TPR_1 437..473 CDD:278916 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.