DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and IFIT5

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_036552.1 Gene:IFIT5 / 24138 HGNCID:13328 Length:482 Species:Homo sapiens


Alignment Length:412 Identity:83/412 - (20%)
Similarity:151/412 - (36%) Gaps:116/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 NLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNL----G 559
            ::|..:|.|.:...|        ||:...||:...|:         |....|..:..:.|    |
Human   106 HMDQLEEAQKYTGKI--------GNVCKKLSSPSNYK---------LECPETDCEKGWALLKFGG 153

  Fly   560 VVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQE------AISVLRTGARLEG 618
            ..:||      |...|.:|:|:.|......:....::..|.|..:|      ::..||....|..
Human   154 KYYQK------AKAAFEKALEVEPDNPEFNIGYAITVYRLDDSDREGSVKSFSLGPLRKAVTLNP 212

  Fly   619 S--------GVRDRGAHVEARYTCYLQ---------------LSVLYRSDGRLQDAAAALRESLK 660
            .        .::.:..|.||....|::               .:..||.......|...|:::|:
Human   213 DNSYIKVFLALKLQDVHAEAEGEKYIEEILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALE 277

  Fly   661 ALPLLPQKQRAVLHLRLGEIL-AELQDWNEAEHQQ--------------------RLAMQLQPEQ 704
            ..|     ..:.||.::|... |::....:|.|.:                    :.||:.....
Human   278 VTP-----TSSFLHHQMGLCYRAQMIQIKKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMF 337

  Fly   705 GAAYVTYGQTLARNGSRLAEAESWFKRALQLAPL----EPSSHHHYADFLEQQER------HH-- 757
            ..||.......| .|.:.:.||..|::||:|..:    :...|:||..|.|...:      ||  
Human   338 AFAYTDLANMYA-EGGQYSNAEDIFRKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYL 401

  Fly   758 EALGLRLRAAALAPQDYTLQSCVADALRLLN--RLAEAELWYRKAVTLQPMAAHAHANLGAILQM 820
            |||.::.|:        .|::.:..||:.|:  ||.      ..|:.:|.::|     ||.:.::
Human   402 EALKVKDRS--------PLRTKLTSALKKLSTKRLC------HNALDVQSLSA-----LGFVYKL 447

  Fly   821 RGLRKEAVACYHKALELQPGHA 842
            .|.:::|...|.||.::.|.:|
Human   448 EGEKRQAAEYYEKAQKIDPENA 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 15/68 (22%)
TPR repeat 518..546 CDD:276809 5/27 (19%)
TPR repeat 551..581 CDD:276809 7/33 (21%)
TPR_1 552..584 CDD:278916 8/35 (23%)
TPR 565..841 CDD:223533 67/339 (20%)
TPR repeat 586..611 CDD:276809 3/30 (10%)
TPR repeat 634..660 CDD:276809 5/40 (13%)
TPR repeat 671..699 CDD:276809 7/48 (15%)
TPR repeat 704..735 CDD:276809 9/30 (30%)
TPR repeat 740..768 CDD:276809 11/35 (31%)
TPR repeat 773..803 CDD:276809 7/31 (23%)
TPR 808..841 CDD:197478 9/32 (28%)
TPR repeat 808..836 CDD:276809 8/27 (30%)
IFIT5NP_036552.1 TPR_12 49..116 CDD:315987 3/9 (33%)
TPR 1 51..84
TPR repeat 53..79 CDD:276809
TPR repeat 84..133 CDD:276809 8/34 (24%)
TPR 2 94..127 6/28 (21%)
TPR 3 138..173 10/40 (25%)
TPR repeat 138..168 CDD:276809 8/35 (23%)
PEP_TPR_lipo <157..470 CDD:274350 70/344 (20%)
TPR 4 181..214 6/32 (19%)
TPR repeat 214..244 CDD:276809 4/29 (14%)
TPR 5 249..282 6/37 (16%)
TPR repeat 249..277 CDD:276809 4/27 (15%)
Interaction with the 5'-triphosphate group of PPP-RNA 254..260 0/5 (0%)
TPR repeat 282..333 CDD:276809 8/50 (16%)
TPR 6 338..371 10/33 (30%)
TPR repeat 338..366 CDD:276809 8/28 (29%)
TPR 7 376..410 10/33 (30%)
TPR repeat 376..405 CDD:276809 9/28 (32%)
TPR 8 435..468 10/37 (27%)
TPR repeat 435..463 CDD:276809 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.