DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and Uty

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:XP_017174175.1 Gene:Uty / 22290 MGIID:894810 Length:1236 Species:Mus musculus


Alignment Length:442 Identity:84/442 - (19%)
Similarity:146/442 - (33%) Gaps:145/442 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 HHQLSAPSYRSASAIYSTSSKSKSASWTAA--------------PILGTAFLVLPFLPASNLL-- 436
            |..|....|..|.:.|......::..|.|.              .:|...|....||....|:  
Mouse    96 HFNLLLEDYSKALSSYQRYYSLQTDYWKAFQNHFWWWKITREVWKLLLRKFRNAAFLYGLGLVYF 160

  Fly   437 FYVGFVMA----ERVLYLPSVGYC----LLFGLGFGHLWQRVNSSWRSRL------MLLCGLALL 487
            :|..|..|    :.|||: ...:|    :...|||   ..::|:.:.|.|      ::.|.:..|
Mouse   161 YYNAFQWAIRAFQEVLYV-DPNFCRAKEIHLRLGF---MFKMNTDYESSLKHFQLALIDCNVCTL 221

  Fly   488 LGV----------------HGVR------------------TFRRNLDWR--------DEEQLFR 510
            ..|                |..:                  |..:.|.|.        |.....|
Mouse   222 SSVEIQFHIAHLYETQRKYHSAKAAYEQLLQIESLPSQVKATVLQQLGWMHHNMDLIGDNTTKER 286

  Fly   511 SAISI---------NPPKALGNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVHQKQL 566
            .||..         |..::...||...|..|:.::|.::.|.::......||...::||::|:|.
Mouse   287 YAIQYLQKSLEEDPNSGQSWYFLGRCYSCIGKVQDAFVSYRQSIDKSEASADTWCSIGVLYQQQN 351

  Fly   567 NFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQEAISVLRTGARLEG----SGVRDRGAH 627
            ....|:..:..|::|....|.|:::||. |....:..|:||......||.:.    |.:..|...
Mouse   352 QPMDALQAYICAVQLDHGHAAAWMDLGI-LYESCNQPQDAIKCYLNAARSKSCNNTSALTSRIKF 415

  Fly   628 VEARYTCYLQLSVLYRSDGRLQDAAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAEH 692
            ::|: .|.|..|              :|:...|.||.:.:.                  |:    
Mouse   416 LQAQ-LCNLPQS--------------SLQNKTKLLPSIEEA------------------WS---- 443

  Fly   693 QQRLAMQLQPEQGAAYVTYGQTLARNGSRLAEAESWFKRALQLAPLEPSSHH 744
             ..:..:|...||          |.|.::.:.:::|  .::|.|     |||
Mouse   444 -LPIPAELTSRQG----------AMNTAQQSVSDTW--NSVQTA-----SHH 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 15/64 (23%)
TPR repeat 518..546 CDD:276809 6/27 (22%)
TPR repeat 551..581 CDD:276809 8/29 (28%)
TPR_1 552..584 CDD:278916 9/31 (29%)
TPR 565..841 CDD:223533 36/184 (20%)
TPR repeat 586..611 CDD:276809 8/24 (33%)
TPR repeat 634..660 CDD:276809 4/25 (16%)
TPR repeat 671..699 CDD:276809 1/27 (4%)
TPR repeat 704..735 CDD:276809 5/30 (17%)
TPR repeat 740..768 CDD:276809 3/5 (60%)
TPR repeat 773..803 CDD:276809
TPR 808..841 CDD:197478
TPR repeat 808..836 CDD:276809
UtyXP_017174175.1 TPR repeat 88..116 CDD:276809 5/19 (26%)
TPR repeat 121..178 CDD:276809 12/56 (21%)
TPR 130..397 CDD:223533 53/271 (20%)
TPR repeat 183..213 CDD:276809 7/32 (22%)
TPR repeat 224..252 CDD:276809 2/27 (7%)
TPR repeat 262..297 CDD:276809 7/34 (21%)
TPR repeat 304..331 CDD:276809 6/26 (23%)
TPR repeat 336..366 CDD:276809 8/29 (28%)
TPR repeat 371..399 CDD:276809 8/28 (29%)
JmjC 935..999 CDD:214721
JmjC 969..1077 CDD:334913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.