| Sequence 1: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_940863.3 | Gene: | LONRF2 / 164832 | HGNCID: | 24788 | Length: | 754 | Species: | Homo sapiens |
| Alignment Length: | 238 | Identity: | 58/238 - (24%) |
|---|---|---|---|
| Similarity: | 82/238 - (34%) | Gaps: | 86/238 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 660 KALPLLPQKQRAVLHLRLG--EILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYGQTLARNGSRL 722
Fly 723 AEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAAL------------------ 769
Fly 770 --APQDYTLQSCVADALRLLNRLAEAELWYRKAVTL----------------QPMAAHAHANLGA 816
Fly 817 IL---------------QMRGLRKE-----AVACYHKALELQP 839 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
| TPR_11 | 518..583 | CDD:290150 | |||
| TPR repeat | 518..546 | CDD:276809 | |||
| TPR repeat | 551..581 | CDD:276809 | |||
| TPR_1 | 552..584 | CDD:278916 | |||
| TPR | 565..841 | CDD:223533 | 58/238 (24%) | ||
| TPR repeat | 586..611 | CDD:276809 | |||
| TPR repeat | 634..660 | CDD:276809 | 58/238 (24%) | ||
| TPR repeat | 671..699 | CDD:276809 | 8/29 (28%) | ||
| TPR repeat | 704..735 | CDD:276809 | 12/30 (40%) | ||
| TPR repeat | 740..768 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 773..803 | CDD:276809 | 8/29 (28%) | ||
| TPR | 808..841 | CDD:197478 | 11/52 (21%) | ||
| TPR repeat | 808..836 | CDD:276809 | 7/47 (15%) | ||
| LONRF2 | NP_940863.3 | TPR 1 | 23..58 | 10/41 (24%) | |
| TPR_16 | 27..92 | CDD:372602 | 24/73 (33%) | ||
| TPR 2 | 59..91 | 13/33 (39%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..136 | 0/23 (0%) | |||
| RING1-HC_LONFs | 143..174 | CDD:319427 | 8/41 (20%) | ||
| TPR 3 | 197..230 | 9/32 (28%) | |||
| TPR repeat | 200..225 | CDD:276809 | 5/24 (21%) | ||
| TPR repeat | 230..260 | CDD:276809 | |||
| TPR 4 | 231..264 | ||||
| TPR repeat | 265..293 | CDD:276809 | |||
| TPR 5 | 266..298 | ||||
| PEX10 | <380..489 | CDD:227861 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 398..439 | ||||
| RING2-HC_LONFs | 446..487 | CDD:319428 | |||
| TPR 6 | 447..483 | ||||
| RING-HC finger (C3HC4-type) | 449..486 | CDD:319428 | |||
| LON_substr_bdg | 538..738 | CDD:366967 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||