DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc1 and TTC24

DIOPT Version :10

Sequence 1:NP_995615.2 Gene:Tmtc1 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:XP_011507555.2 Gene:TTC24 / 164118 HGNCID:32348 Length:689 Species:Homo sapiens


Alignment Length:409 Identity:103/409 - (25%)
Similarity:147/409 - (35%) Gaps:92/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 GLALLLGVHGVRTFRRNLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELTLRMTLGH 547
            ||.|||..|.....:..   |..:|.|..|::.:   |||.|...|:...|          .|||
Human    98 GLELLLRAHPEEKAQGR---RHGDQCFNVALAYH---ALGELPQALAWYHR----------ALGH 146

  Fly   548 RPTMAD---AHFNLGVVHQKQLNFSSAIPCFRRAIEL---RPQLAVAYLNLGTS---LISLGDHR 603
            .....|   |...:|..:|.......|..|.:.|.:.   ..||..|.|.||.:   ::..|.||
Human   147 YQPQGDQGEAWAKMGACYQALGQPELAAHCLQEASQAYAQERQLRAAALALGAAAGCMLKSGRHR 211

  Fly   604 -QEAISVLRTGARL-EGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRESLKALPL-- 664
             .|.:.||....|| |.|..|....|:      |..|.:.|   .:||....|:...|:||||  
Human   212 VGEVVQVLEKSRRLAERSTERRLLGHL------YNDLGLGY---SQLQLFPLAVEAFLQALPLCW 267

  Fly   665 LPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQP------EQGAAYVTYGQTLARNGSRLA 723
            :|.:|..||. .||.....|.::.||....:.|..|..      |||.::.:....|::.|...|
Human   268 VPGEQATVLR-NLGMAHNALGNYQEAREFHQKAADLHGSVGQRWEQGRSFGSLAFALSQLGDHKA 331

  Fly   724 EAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQ-------SC-- 779
            ..:::. .|||.|          .|..:.:.:.....||...||.|...|..|:       .|  
Human   332 ARDNYL-HALQAA----------RDSGDMKGQWQACEGLGAAAARLGQYDQALKYYKEALAQCQK 385

  Fly   780 ------------VADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEA----V 828
                        :||.:|  .|||:..|.....:|..|....|.   |...|..|...:|    .
Human   386 EPDSVRERLVAKLADTVR--TRLAQVGLVQTHTLTSAPGRLQAP---GGASQAEGTPAKAGSSTA 445

  Fly   829 ACYHKAL------ELQPGH 841
            ...|::.      |.:.||
Human   446 GVQHRSSSGWEDEEFEEGH 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc1NP_995615.2 ArnT 11..>209 CDD:441412
TMTC_DUF1736 271..340 CDD:462468
PilF 501..585 CDD:442297 20/89 (22%)
TPR repeat 518..546 CDD:276809 6/27 (22%)
TPR repeat 551..581 CDD:276809 7/32 (22%)
LapB 556..838 CDD:442196 80/328 (24%)
TPR repeat 586..611 CDD:276809 9/28 (32%)
TPR repeat 634..660 CDD:276809 6/25 (24%)
TPR repeat 671..699 CDD:276809 8/27 (30%)
TPR repeat 704..735 CDD:276809 7/30 (23%)
TPR repeat 740..768 CDD:276809 4/27 (15%)
TPR repeat 773..803 CDD:276809 10/50 (20%)
TPR repeat 808..836 CDD:276809 6/37 (16%)
TTC24XP_011507555.2 Spy 29..>182 CDD:443119 26/99 (26%)
TPR repeat 36..64 CDD:276809
TPR repeat 81..111 CDD:276809 6/12 (50%)
TPR repeat 116..146 CDD:276809 10/42 (24%)
TPR 121..408 CDD:440225 82/322 (25%)
TPR repeat 154..180 CDD:276809 5/25 (20%)
TPR repeat 238..264 CDD:276809 8/34 (24%)
TPR repeat 273..301 CDD:276809 8/28 (29%)
TPR repeat 312..342 CDD:276809 7/30 (23%)
TPR repeat 353..381 CDD:276809 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.