DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc1 and DNAAF4

DIOPT Version :10

Sequence 1:NP_995615.2 Gene:Tmtc1 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_570722.2 Gene:DNAAF4 / 161582 HGNCID:21493 Length:420 Species:Homo sapiens


Alignment Length:247 Identity:47/247 - (19%)
Similarity:79/247 - (31%) Gaps:98/247 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 RNL--DWRDEEQLFRSAI---SINPPKALGNL----------GSVLSAQGRYEEAELTLRMTLGH 547
            |||  ..|:.|.:|...:   ||..|:::|::          .::..:|...||..|       |
Human   207 RNLAPKGRNSENIFTEKLKEDSIPAPRSVGSIKINFTPRVFPTALRESQVAEEEEWL-------H 264

  Fly   548 RPTMADAHFNLGVVHQKQL---------------------NFSSAIPCFRRAIELRPQLAVAYLN 591
            :...|....|..:.....|                     |:.:||..:..||.|..::.:.|||
Human   265 KQAEARRAMNTDIAELCDLKEEEKNPEWLKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLN 329

  Fly   592 LGTSLISLGDHRQEAISVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALR 656
                                                   |..|:|:|..|::          |:.
Human   330 ---------------------------------------RAACHLKLKNLHK----------AIE 345

  Fly   657 ESLKALPLL------PQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQP 702
            :|.|||.||      ....|...|:|.|....:|:.:.|.......|:::.|
Human   346 DSSKALELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc1NP_995615.2 ArnT 11..>209 CDD:441412
TMTC_DUF1736 271..340 CDD:462468
PilF 501..585 CDD:442297 21/117 (18%)
TPR repeat 518..546 CDD:276809 6/37 (16%)
TPR repeat 551..581 CDD:276809 8/50 (16%)
LapB 556..838 CDD:442196 31/174 (18%)
TPR repeat 586..611 CDD:276809 3/24 (13%)
TPR repeat 634..660 CDD:276809 6/25 (24%)
TPR repeat 671..699 CDD:276809 6/27 (22%)
TPR repeat 704..735 CDD:276809
TPR repeat 740..768 CDD:276809
TPR repeat 773..803 CDD:276809
TPR repeat 808..836 CDD:276809
DNAAF4NP_570722.2 Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000269|PubMed:19423554 7..103
p23_DYX1C1_like 10..87 CDD:107226
TPR 1 290..323 6/32 (19%)
TPR repeat 290..318 CDD:276809 4/27 (15%)
NlpI <297..>399 CDD:443815 29/150 (19%)
TPR repeat 323..353 CDD:276809 13/78 (17%)
TPR 2 324..357 15/81 (19%)
TPR repeat 364..394 CDD:276809 7/29 (24%)
TPR 3 366..399 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.