DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and DNAAF4

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_570722.2 Gene:DNAAF4 / 161582 HGNCID:21493 Length:420 Species:Homo sapiens


Alignment Length:247 Identity:47/247 - (19%)
Similarity:79/247 - (31%) Gaps:98/247 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 RNL--DWRDEEQLFRSAI---SINPPKALGNL----------GSVLSAQGRYEEAELTLRMTLGH 547
            |||  ..|:.|.:|...:   ||..|:::|::          .::..:|...||..|       |
Human   207 RNLAPKGRNSENIFTEKLKEDSIPAPRSVGSIKINFTPRVFPTALRESQVAEEEEWL-------H 264

  Fly   548 RPTMADAHFNLGVVHQKQL---------------------NFSSAIPCFRRAIELRPQLAVAYLN 591
            :...|....|..:.....|                     |:.:||..:..||.|..::.:.|||
Human   265 KQAEARRAMNTDIAELCDLKEEEKNPEWLKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLN 329

  Fly   592 LGTSLISLGDHRQEAISVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALR 656
                                                   |..|:|:|..|::          |:.
Human   330 ---------------------------------------RAACHLKLKNLHK----------AIE 345

  Fly   657 ESLKALPLL------PQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQP 702
            :|.|||.||      ....|...|:|.|....:|:.:.|.......|:::.|
Human   346 DSSKALELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 16/95 (17%)
TPR repeat 518..546 CDD:276809 6/37 (16%)
TPR repeat 551..581 CDD:276809 8/50 (16%)
TPR_1 552..584 CDD:278916 9/52 (17%)
TPR 565..841 CDD:223533 30/165 (18%)
TPR repeat 586..611 CDD:276809 3/24 (13%)
TPR repeat 634..660 CDD:276809 6/25 (24%)
TPR repeat 671..699 CDD:276809 6/27 (22%)
TPR repeat 704..735 CDD:276809
TPR repeat 740..768 CDD:276809
TPR repeat 773..803 CDD:276809
TPR 808..841 CDD:197478
TPR repeat 808..836 CDD:276809
DNAAF4NP_570722.2 Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000269|PubMed:19423554 7..103
p23_DYX1C1_like 10..87 CDD:107226
TPR_11 289..353 CDD:290150 19/112 (17%)
TPR 1 290..323 6/32 (19%)
TPR repeat 290..318 CDD:276809 4/27 (15%)
TPR repeat 323..353 CDD:276809 13/78 (17%)
TPR 2 324..357 15/81 (19%)
TPR repeat 364..394 CDD:276809 7/29 (24%)
TPR 3 366..399 7/32 (22%)
TPR_1 367..399 CDD:278916 7/31 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.