DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and TTC32

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001008238.1 Gene:TTC32 / 130502 HGNCID:32954 Length:151 Species:Homo sapiens


Alignment Length:171 Identity:41/171 - (23%)
Similarity:66/171 - (38%) Gaps:37/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   698 MQLQPEQGAAYVTYGQTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGL 762
            |:.|.::..|.:|..|....|| ..||||:.:...::......||              .|:.| 
Human     1 MEGQRQESHATLTLAQAHFNNG-EYAEAEALYSAYIRRCACAASS--------------DESPG- 49

  Fly   763 RLRAAALAPQDYTLQSCVADALRLLNR---------LAEAELWYRKAVTLQPMAAHAHANLGAIL 818
                :..:|:|      :|.|..  ||         ..||...|..|:.:||.....:.|.|.||
Human    50 ----SKCSPED------LATAYN--NRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLIL 102

  Fly   819 QMRGLRKEAVACYHKALELQPGHAISRANLARMNVHKHENE 859
            ...|...:|:..:.|.|:|.||...:..:|.:..:.|.|.:
Human   103 YRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQ 143

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150
TPR repeat 518..546 CDD:276809
TPR repeat 551..581 CDD:276809
TPR_1 552..584 CDD:278916
TPR 565..841 CDD:223533 37/151 (25%)
TPR repeat 586..611 CDD:276809
TPR repeat 634..660 CDD:276809