DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and Ifit1bl2

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001349059.1 Gene:Ifit1bl2 / 112419 MGIID:2148249 Length:466 Species:Mus musculus


Alignment Length:443 Identity:98/443 - (22%)
Similarity:174/443 - (39%) Gaps:137/443 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 LGVHGVRTFRRNLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELTLR--MTLG---- 546
            :|:|.:..:.|:|..:.:|.                |.|:..|:...:..:|:.|  .|.|    
Mouse    60 IGMHNLLAYVRHLKGQQDEA----------------LQSLKEAEALIQSEQLSKRSLATWGNCAW 108

  Fly   547 ---HRPTMADAHFNLGVVHQKQLNFSS-----------------------------AIPCFRRAI 579
               ||.::|:|...|..|.:....|||                             |:.||.||:
Mouse   109 LHYHRGSLAEAQVYLDKVEKVCKEFSSPFRYRLECAEMDCEEGWALRKCGSQNYTRAMACFERAL 173

  Fly   580 ELRPQ--------LAVAY-LNL--GTSLISLGDHRQEAISV------LRTGARLEGSGVR---DR 624
            ::.|:        ..||| |:.  |.||..|    ::|:||      |:....|:...:|   :.
Mouse   174 KVEPENPEYNAGYADVAYHLDYYDGNSLQPL----KKAVSVKPEDPYLKVLLALKLQDLRKTDEA 234

  Fly   625 GAHV-EARYTCYLQLSV------LYRSDGRLQDAAAALRESLKALPLLPQKQRAVLHLRLG---- 678
            ..|: ||..|...|.::      .||..|.:::|...|:::|:..|..|     .||.::|    
Mouse   235 EKHIKEATLTISSQNNIFGYVAKFYRRKGCVEEALGFLKKALETKPSSP-----YLHFQIGLCHK 294

  Fly   679 EILAELQDWNEAEHQQRL-------------AMQLQPEQGAAYVTYGQTLARNGSRLAEAESWFK 730
            ....:::.....|:::|.             .::|:|....||:...:..|:|..: .|||..|:
Mouse   295 TQFFQMKKATSRENRKRADQSCHLAICHFKKTLELKPTYDRAYIDLAEVYAKNHQQ-KEAEDNFQ 358

  Fly   731 RALQLAPL----EPSSHHHYADFLEQQERHHEAL------GLRLRAAALAPQDYTLQSCVAD-AL 784
            ..|.::.|    :...|..|.:|.:..::..||.      ||::.          :.|...| .|
Mouse   359 EVLSMSNLGDYMQQEIHFRYGNFQQYYKKSEEAAITHYLKGLKIE----------VTSHYRDKLL 413

  Fly   785 RLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALEL 837
            :.|..|||..   ::...|:.::.     ||.:.::||...||::||.|||.|
Mouse   414 KALEELAEGR---KEDHVLESLSL-----LGLVCRLRGDTSEAMSCYEKALRL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 21/102 (21%)
TPR repeat 518..546 CDD:276809 6/29 (21%)
TPR repeat 551..581 CDD:276809 12/58 (21%)
TPR_1 552..584 CDD:278916 12/60 (20%)
TPR 565..841 CDD:223533 80/357 (22%)
TPR repeat 586..611 CDD:276809 11/33 (33%)
TPR repeat 634..660 CDD:276809 6/31 (19%)
TPR repeat 671..699 CDD:276809 5/44 (11%)
TPR repeat 704..735 CDD:276809 9/30 (30%)
TPR repeat 740..768 CDD:276809 7/33 (21%)
TPR repeat 773..803 CDD:276809 7/30 (23%)
TPR 808..841 CDD:197478 12/30 (40%)
TPR repeat 808..836 CDD:276809 10/27 (37%)
Ifit1bl2NP_001349059.1 TPR_11 <63..>353 CDD:330823 64/315 (20%)
TPR repeat 63..94 CDD:276809 7/46 (15%)
TPR repeat 99..129 CDD:276809 8/29 (28%)
TPR repeat 144..174 CDD:276809 5/29 (17%)
TPR repeat 179..210 CDD:276809 9/34 (26%)
TPR repeat 215..241 CDD:276809 4/25 (16%)
TPR repeat 282..329 CDD:276809 6/51 (12%)
TPR_11 <324..>458 CDD:330823 38/152 (25%)
TPR repeat 334..362 CDD:276809 8/28 (29%)
TPR repeat 372..401 CDD:276809 6/28 (21%)
TPR repeat 429..457 CDD:276809 11/32 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.