DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and TOMM34

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_006800.2 Gene:TOMM34 / 10953 HGNCID:15746 Length:309 Species:Homo sapiens


Alignment Length:394 Identity:76/394 - (19%)
Similarity:125/394 - (31%) Gaps:142/394 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 RNLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVH 562
            ||..:.:...|:..|:            .||.|||..:..|.::            .:.|....|
Human    21 RNGQYAEASALYGRAL------------RVLQAQGSSDPEEESV------------LYSNRAACH 61

  Fly   563 QKQLNFSSAI---------------PCFRR--AIELRPQLAVAYLNLGTSLISLGDHRQEAISVL 610
            .|..|....|               |..||  |.|...:..:||::..| ::.:.|:...|:   
Human    62 LKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKT-VLQIDDNVTSAV--- 122

  Fly   611 RTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDA-AAALRESLKALPLLP---QKQRA 671
                  ||                      :.|....|.|: ....|..|.::||:|   ||:  
Human   123 ------EG----------------------INRMTRALMDSLGPEWRLKLPSIPLVPVSAQKR-- 157

  Fly   672 VLHLRLGEILAELQDWNE--AEHQQRLAMQLQPE--------QGAAYVTYGQTLARNGSRLAEAE 726
                           ||.  :|:.:.:|.....|        ..|..|...:.|...|:.|.   
Human   158 ---------------WNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELV--- 204

  Fly   727 SWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYT--LQSCVADALRLLNR 789
               |:......:|..|.......||.....:.||      ..|..:.||  ::.| .:||:|..:
Human   205 ---KKGNHKKAIEKYSESLLCSNLESATYSNRAL------CYLVLKQYTEAVKDC-TEALKLDGK 259

  Fly   790 LAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLR--KEAVACYHKALELQP--GHAISRANLAR 850
            ..:|  :||:        |.||         :.|:  |.:.|.....|:::|  |.|.......:
Human   260 NVKA--FYRR--------AQAH---------KALKDYKSSFADISNLLQIEPRNGPAQKLRQEVK 305

  Fly   851 MNVH 854
            .|:|
Human   306 QNLH 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 16/81 (20%)
TPR repeat 518..546 CDD:276809 6/27 (22%)
TPR repeat 551..581 CDD:276809 9/46 (20%)
TPR_1 552..584 CDD:278916 10/48 (21%)
TPR 565..841 CDD:223533 59/312 (19%)
TPR repeat 586..611 CDD:276809 5/24 (21%)
TPR repeat 634..660 CDD:276809 4/26 (15%)
TPR repeat 671..699 CDD:276809 4/29 (14%)
TPR repeat 704..735 CDD:276809 6/30 (20%)
TPR repeat 740..768 CDD:276809 5/27 (19%)
TPR repeat 773..803 CDD:276809 9/31 (29%)
TPR 808..841 CDD:197478 8/36 (22%)
TPR repeat 808..836 CDD:276809 6/29 (21%)
TOMM34NP_006800.2 TPR 1 9..42 6/32 (19%)
TPR repeat 9..37 CDD:276809 4/27 (15%)
PLN03088 <12..>294 CDD:330826 72/377 (19%)
TPR repeat 50..80 CDD:276809 5/41 (12%)
TPR 2 51..84 5/44 (11%)
TPR repeat 85..113 CDD:276809 8/28 (29%)
TPR 3 86..118 9/32 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..189 4/27 (15%)
TPR 4 193..226 6/38 (16%)
TPR repeat 193..221 CDD:276809 6/33 (18%)
TPR repeat 226..256 CDD:276809 9/36 (25%)
TPR 5 227..260 9/39 (23%)
TPR repeat 261..289 CDD:276809 9/46 (20%)
TPR 6 262..294 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.