DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc1 and TOMM34

DIOPT Version :10

Sequence 1:NP_995615.2 Gene:Tmtc1 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_006800.2 Gene:TOMM34 / 10953 HGNCID:15746 Length:309 Species:Homo sapiens


Alignment Length:394 Identity:76/394 - (19%)
Similarity:125/394 - (31%) Gaps:142/394 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 RNLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVH 562
            ||..:.:...|:..|:            .||.|||..:..|.::            .:.|....|
Human    21 RNGQYAEASALYGRAL------------RVLQAQGSSDPEEESV------------LYSNRAACH 61

  Fly   563 QKQLNFSSAI---------------PCFRR--AIELRPQLAVAYLNLGTSLISLGDHRQEAISVL 610
            .|..|....|               |..||  |.|...:..:||::..| ::.:.|:...|:   
Human    62 LKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKT-VLQIDDNVTSAV--- 122

  Fly   611 RTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDA-AAALRESLKALPLLP---QKQRA 671
                  ||                      :.|....|.|: ....|..|.::||:|   ||:  
Human   123 ------EG----------------------INRMTRALMDSLGPEWRLKLPSIPLVPVSAQKR-- 157

  Fly   672 VLHLRLGEILAELQDWNE--AEHQQRLAMQLQPE--------QGAAYVTYGQTLARNGSRLAEAE 726
                           ||.  :|:.:.:|.....|        ..|..|...:.|...|:.|.   
Human   158 ---------------WNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELV--- 204

  Fly   727 SWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYT--LQSCVADALRLLNR 789
               |:......:|..|.......||.....:.||      ..|..:.||  ::.| .:||:|..:
Human   205 ---KKGNHKKAIEKYSESLLCSNLESATYSNRAL------CYLVLKQYTEAVKDC-TEALKLDGK 259

  Fly   790 LAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLR--KEAVACYHKALELQP--GHAISRANLAR 850
            ..:|  :||:        |.||         :.|:  |.:.|.....|:::|  |.|.......:
Human   260 NVKA--FYRR--------AQAH---------KALKDYKSSFADISNLLQIEPRNGPAQKLRQEVK 305

  Fly   851 MNVH 854
            .|:|
Human   306 QNLH 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc1NP_995615.2 ArnT 11..>209 CDD:441412
TMTC_DUF1736 271..340 CDD:462468
PilF 501..585 CDD:442297 18/100 (18%)
TPR repeat 518..546 CDD:276809 6/27 (22%)
TPR repeat 551..581 CDD:276809 9/46 (20%)
LapB 556..838 CDD:442196 61/316 (19%)
TPR repeat 586..611 CDD:276809 5/24 (21%)
TPR repeat 634..660 CDD:276809 4/26 (15%)
TPR repeat 671..699 CDD:276809 4/29 (14%)
TPR repeat 704..735 CDD:276809 6/30 (20%)
TPR repeat 740..768 CDD:276809 5/27 (19%)
TPR repeat 773..803 CDD:276809 9/31 (29%)
TPR repeat 808..836 CDD:276809 6/29 (21%)
TOMM34NP_006800.2 TPR 1 9..42 6/32 (19%)
TPR repeat 9..37 CDD:276809 4/27 (15%)
3a0801s09 <12..>294 CDD:273380 72/377 (19%)
TPR repeat 50..80 CDD:276809 5/41 (12%)
TPR 2 51..84 5/44 (11%)
TPR repeat 85..113 CDD:276809 8/28 (29%)
TPR 3 86..118 9/32 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..189 4/27 (15%)
TPR 4 193..226 6/38 (16%)
TPR repeat 193..221 CDD:276809 6/33 (18%)
TPR repeat 226..256 CDD:276809 9/36 (25%)
TPR 5 227..260 9/39 (23%)
TPR repeat 261..289 CDD:276809 9/46 (20%)
TPR 6 262..294 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.