| Sequence 1: | NP_995615.2 | Gene: | CG31690 / 33455 | FlyBaseID: | FBgn0051690 | Length: | 859 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001923918.1 | Gene: | fkbpl / 100149636 | ZFINID: | ZDB-GENE-030131-4744 | Length: | 361 | Species: | Danio rerio |
| Alignment Length: | 330 | Identity: | 73/330 - (22%) |
|---|---|---|---|
| Similarity: | 119/330 - (36%) | Gaps: | 87/330 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 607 ISVLRTG---ARLEGSGVRDRG---------AHVEARYTCYLQLSVLYRSDGRLQDAAAALRESL 659
Fly 660 KALPLLPQKQRAVLH--------LRLGEILAELQD------------------WNEA-------- 690
Fly 691 --EHQQRLAMQ----------LQPEQGAAYVTYGQTLA-------RNGSRLAEAESW-----FKR 731
Fly 732 ALQLA-PLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQS-----------CVADAL 784
Fly 785 RL-LNRLAEAELWYRKAVTLQPMAAHAHANLG-AILQMRGLRKEAVACYHKALELQPGHAISRAN 847
Fly 848 LARMN 852 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31690 | NP_995615.2 | DUF1736 | 272..340 | CDD:285594 | |
| TPR_11 | 518..583 | CDD:290150 | |||
| TPR repeat | 518..546 | CDD:276809 | |||
| TPR repeat | 551..581 | CDD:276809 | |||
| TPR_1 | 552..584 | CDD:278916 | |||
| TPR | 565..841 | CDD:223533 | 69/317 (22%) | ||
| TPR repeat | 586..611 | CDD:276809 | 3/3 (100%) | ||
| TPR repeat | 634..660 | CDD:276809 | 5/25 (20%) | ||
| TPR repeat | 671..699 | CDD:276809 | 9/63 (14%) | ||
| TPR repeat | 704..735 | CDD:276809 | 9/42 (21%) | ||
| TPR repeat | 740..768 | CDD:276809 | 2/27 (7%) | ||
| TPR repeat | 773..803 | CDD:276809 | 8/41 (20%) | ||
| TPR | 808..841 | CDD:197478 | 13/33 (39%) | ||
| TPR repeat | 808..836 | CDD:276809 | 8/28 (29%) | ||
| fkbpl | XP_001923918.1 | TPR_11 | 263..329 | CDD:290150 | 19/66 (29%) |
| TPR repeat | 264..292 | CDD:276809 | 6/27 (22%) | ||
| TPR repeat | 297..327 | CDD:276809 | 9/30 (30%) | ||
| TPR_8 | 299..330 | CDD:289924 | 12/31 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||