DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and ttc32

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001020691.1 Gene:ttc32 / 100004012 ZFINID:ZDB-GENE-041014-158 Length:136 Species:Danio rerio


Alignment Length:143 Identity:32/143 - (22%)
Similarity:48/143 - (33%) Gaps:47/143 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   729 FKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAA--------------ALAPQDYTLQSC 779
            :|||.:|          |..|:|...:..:..|..|..|              ..|..|||    
Zfish    21 YKRAEEL----------YTQFIESCTKSRDCNGQDLAIAYNNRGQVKYLRVDFYEAMDDYT---- 71

  Fly   780 VADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHAIS 844
              .|:. :||..|..|:                |.|.|....|..|||...:.:.|||.|....:
Zfish    72 --SAIH-INRQFEVPLY----------------NRGLIRYRLGFFKEAEGDFRRVLELNPDFKDA 117

  Fly   845 RANLARMNVHKHE 857
            :.:|.:..:.:.|
Zfish   118 KESLNQTLLDREE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150
TPR repeat 518..546 CDD:276809
TPR repeat 551..581 CDD:276809
TPR_1 552..584 CDD:278916
TPR 565..841 CDD:223533 30/125 (24%)
TPR repeat 586..611 CDD:276809
TPR repeat 634..660 CDD:276809
TPR repeat 671..699 CDD:276809
TPR repeat 704..735 CDD:276809 3/5 (60%)
TPR repeat 740..768 CDD:276809 6/41 (15%)
TPR repeat 773..803 CDD:276809 8/29 (28%)
TPR 808..841 CDD:197478 11/32 (34%)
TPR repeat 808..836 CDD:276809 7/27 (26%)
ttc32NP_001020691.1 TPR_11 9..77 CDD:290150 15/72 (21%)
TPR repeat 9..33 CDD:276809 6/21 (29%)
TPR repeat 46..76 CDD:276809 7/36 (19%)
TPR_11 47..112 CDD:290150 20/87 (23%)
TPR repeat 81..109 CDD:276809 9/43 (21%)
TPR_1 84..114 CDD:278916 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.