DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31690 and ifit11

DIOPT Version :9

Sequence 1:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001177393.1 Gene:ifit11 / 100001239 ZFINID:ZDB-GENE-121214-302 Length:483 Species:Danio rerio


Alignment Length:398 Identity:77/398 - (19%)
Similarity:124/398 - (31%) Gaps:137/398 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 EEQLFRSAISINPPKA-LGNLGSVLSAQGRYE---------EAELTLRMTLGH---------RPT 550
            ||.:.|:..|:...|. |||....|:...|.|         ..:.||.:|.|:         ..|
Zfish    51 EEGVARTHCSLGYAKCLLGNKEEALTHLSRSETLIKEKLGNNCDKTLIVTYGNFAWMNYQMENYT 115

  Fly   551 MADAHF-NLGVVHQ----------------KQLNFS-----SAIPCFRRAIELRPQLAVAYLNLG 593
            ..:::. .|..:|:                ..|.||     .|:..|::|:||.|:.:.......
Zfish   116 ECESYLVKLQKIHEMFPAESVPEVLGEKGWAYLKFSYKYYDRAVEAFQKAVELDPENSEWNAGYA 180

  Fly   594 TSLISLGDHRQEAISVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRES 658
            |:|..:    :.|::..||                |....|.:.              :.|:::.
Zfish   181 TALYRI----ETALNPFRT----------------EMDTPCIVD--------------SPAIKQL 211

  Fly   659 LKALPLLPQKQ--RAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVT-YGQTLARNGS 720
            ..|:.:.|...  ||:|.|||  .|...:...|:|.....|:...||.  .:|| |.....||..
Zfish   212 RLAISINPDDDSLRALLGLRL--FLCSKKLMKESEKLMETALNGSPEH--PHVTRYVAKFFRNQG 272

  Fly   721 RLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQSCVADALR 785
            .:..:....:.|||.:|.....||..|                                      
Zfish   273 SVDRSIELLETALQKSPNSGFIHHQLA-------------------------------------- 299

  Fly   786 LLNRLAEAELWYR-KAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHAISRANLA 849
                     :.|: |.:.||......|       |:...|.:.:....||..|:....|:...||
Zfish   300 ---------MCYKTKKIDLQKEKGDRH-------QINNARNQCIYYLEKATSLKDSFIIAMCELA 348

  Fly   850 RMNVHKHE 857
            .....|||
Zfish   349 MQYGEKHE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31690NP_995615.2 DUF1736 272..340 CDD:285594
TPR_11 518..583 CDD:290150 22/105 (21%)
TPR repeat 518..546 CDD:276809 10/37 (27%)
TPR repeat 551..581 CDD:276809 8/51 (16%)
TPR_1 552..584 CDD:278916 10/53 (19%)
TPR 565..841 CDD:223533 53/284 (19%)
TPR repeat 586..611 CDD:276809 3/24 (13%)
TPR repeat 634..660 CDD:276809 2/25 (8%)
TPR repeat 671..699 CDD:276809 9/27 (33%)
TPR repeat 704..735 CDD:276809 7/31 (23%)
TPR repeat 740..768 CDD:276809 3/27 (11%)
TPR repeat 773..803 CDD:276809 2/30 (7%)
TPR 808..841 CDD:197478 6/32 (19%)
TPR repeat 808..836 CDD:276809 5/27 (19%)
ifit11NP_001177393.1 TPR_12 54..129 CDD:290160 15/74 (20%)
TPR repeat 55..83 CDD:276809 8/27 (30%)
TPR repeat 97..127 CDD:276809 5/29 (17%)
TPR_2 137..172 CDD:285020 9/34 (26%)
TPR repeat 137..167 CDD:276809 6/29 (21%)
TPR repeat 172..217 CDD:276809 9/78 (12%)
TPR repeat 224..251 CDD:276809 9/28 (32%)
TPR repeat 291..336 CDD:276809 12/98 (12%)
TPR repeat 341..366 CDD:276809 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.