DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trf5 and TBPL1

DIOPT Version :9

Sequence 1:NP_608700.2 Gene:Trf5 / 33454 FlyBaseID:FBgn0031446 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001240605.1 Gene:TBPL1 / 9519 HGNCID:11589 Length:186 Species:Homo sapiens


Alignment Length:173 Identity:37/173 - (21%)
Similarity:73/173 - (42%) Gaps:3/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LNVIYKPFYCLAMTTSKFHLLELDMGLKNTAFEPEKHMALFVYRYSPTRSIRIYPHGNIYCQ-AF 158
            |:::.....|:..|....:|.::.:...|..::.:....|...| .|..:..|:..|.|.|. |.
Human     9 LDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLR-KPRITATIWSSGKIICTGAT 72

  Fly   159 CKNSARYGLANILKELRYLGYAPRLRRLKTNAVNATFSVPFNLNLRQFHLENPVVTRYDTSKYPF 223
            .:..|::|...:.:.|:.||:.......|...|.|..::||.:.|.:|...|.....|:...:|.
Human    73 SEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPA 137

  Fly   224 LVYKMMGTTVEIAIFPTGYVIVLFATTMEITKLAIAHILPTLY 266
            :.|::......:.||.||.:.|. ...::....|:..|.|.::
Human   138 VCYRIKSLRATLQIFSTGSITVT-GPNVKAVATAVEQIYPFVF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trf5NP_608700.2 PLN00062 110..265 CDD:177693 34/155 (22%)
TBP 191..267 CDD:278767 18/76 (24%)
TBPL1NP_001240605.1 TLF 9..180 CDD:239953 37/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.